Recombinant Full Length Human HIST1H2AA Protein, GST-tagged

• Cat.No.: HIST1H2AA-3567HF
• Product Overview: Human HIST1H2AA full-length ORF (AAH62211.1, 1 a.a. - 131 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 131 amino acids
• Description: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. This gene is intronless and encodes a member of the histone H2A family. Transcripts from this gene contain a palindromic termination element. [provided by RefSeq
• Molecular Mass: 40.81 kDa
• AA Sequence: MSGRGKQGGKARAKSKSRSSRAGLQFPVGRIHRLLRKGNYAERIGAGAPVYLAAVLEYLTAEILELAGNASRDNKKTRIIPRHLQLAIRNDEELNKLLGGVTIAQGGVLPNIQAVLLPKKTESHHHKAQSK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HIST1H2AA histone cluster 1, H2aa [ Homo sapiens ]
• Official Symbol: HIST1H2AA
• Synonyms: HIST1H2AA; histone cluster 1, H2aa; H2A histone family, member R , histone 1, H2aa; histone H2A type 1-A; bA317E16.2; H2AFR; histone H2A/r; histone 1, H2aa; H2A histone family, member R; H2AA
• Gene ID: 221613
• mRNA Refseq: NM_170745
• Protein Refseq: NP_734466
• MIM: 613499
• UniProt ID: Q96QV6