Recombinant Full Length Human HIBADH Protein, GST-tagged

• Cat.No.: HIBADH-3463HF
• Product Overview: Human HIBADH full-length ORF ( NP_689953.1, 1 a.a. - 336 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: 3-hydroxyisobutyrate dehydrogenase (3-hydroxy-2-methylpropanoate:NAD(+) oxidoreductase, EC 1.1.1.31) is a dimeric mitochondrial enzyme that catalyzes the NAD(+)-dependent, reversible oxidation of 3-hydroxyisobutyrate, an intermediate of valine catabolism, to methylmalonate semialdehyde.[supplied by OMIM
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 61.7 kDa
• Protein length: 336 amino acids
• AA Sequence: MAASLRLLGAASGLRYWSRRLRPAAGSFAAVCSRSVASKTPVGFIGLGNMGNPMAKNLMKHGYPLIIYDVFPDACKEFQDAGEQVVSSPADVAEKADRIITMLPTSINAIEAYSGANGILKKVKKGSLLIDSSTIDPAVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVEDEFAAAQELLGCMGSNVVYCGAVGTGQAAKICNNMLLAISMIGTAEAMNLGIRLGLDPKLLAKILNMSSGRCWSSDTYNPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPILLGSLAHQIYRMMCAKGYSKKDFSSVFQFLREEETF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HIBADH 3-hydroxyisobutyrate dehydrogenase [ Homo sapiens ]
• Official Symbol: HIBADH
• Synonyms: HIBADH; 3-hydroxyisobutyrate dehydrogenase; 3-hydroxyisobutyrate dehydrogenase, mitochondrial; NS5ATP1; MGC40361
• Gene ID: 11112
• mRNA Refseq: NM_152740
• Protein Refseq: NP_689953
• MIM: 608475
• UniProt ID: P31937