Recombinant Full Length Human HHLA3 Protein, GST-tagged
Cat.No. : | HHLA3-3460HF |
Product Overview : | Human HHLA3 full-length ORF (AAH10922.1, 1 a.a. - 121 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 121 amino acids |
Description : | HHLA3 (HERV-H LTR-Associating 3) is a Protein Coding gene. |
Molecular Mass : | 39.71 kDa |
AA Sequence : | MFGACYKQPLKPSGSEPPAEECRMTPRHAGCDVTEMQRILSQPTFTEHLLRAVCLVNGKGSLSRPQESILGSLARKNLRRIHRVSLVMCVRPLSPSKAIISPVTCMYTSRWPEASEESQKK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HHLA3 HERV-H LTR-associating 3 [ Homo sapiens ] |
Official Symbol | HHLA3 |
Synonyms | HHLA3; HERV-H LTR-associating 3; HERV-H LTR-associating protein 3; human endogenous retrovirus-H long terminal repeat-associating 3; human endogenous retrovirus-H long terminal repeat-associating protein 3; |
Gene ID | 11147 |
mRNA Refseq | NM_001031693 |
Protein Refseq | NP_001026863 |
MIM | 604372 |
UniProt ID | Q9XRX5 |
◆ Recombinant Proteins | ||
HHLA3-247H | Recombinant Human HHLA3 Protein, MYC/DDK-tagged | +Inquiry |
HHLA3 -250H | Recombinant Human HHLA3 Protein, His-tagged | +Inquiry |
HHLA3-2485H | Recombinant Human HHLA3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HHLA3-4739H | Recombinant Human HHLA3 Protein, GST-tagged | +Inquiry |
HHLA3-3460HF | Recombinant Full Length Human HHLA3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HHLA3-5567HCL | Recombinant Human HHLA3 293 Cell Lysate | +Inquiry |
HHLA3-5568HCL | Recombinant Human HHLA3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HHLA3 Products
Required fields are marked with *
My Review for All HHLA3 Products
Required fields are marked with *
0
Inquiry Basket