Recombinant Full Length Human HHLA3 Protein, GST-tagged

• Cat.No.: HHLA3-3460HF
• Product Overview: Human HHLA3 full-length ORF (AAH10922.1, 1 a.a. - 121 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: HHLA3 (HERV-H LTR-Associating 3) is a Protein Coding gene.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 39.71 kDa
• Protein length: 121 amino acids
• AA Sequence: MFGACYKQPLKPSGSEPPAEECRMTPRHAGCDVTEMQRILSQPTFTEHLLRAVCLVNGKGSLSRPQESILGSLARKNLRRIHRVSLVMCVRPLSPSKAIISPVTCMYTSRWPEASEESQKK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HHLA3 HERV-H LTR-associating 3 [ Homo sapiens ]
• Official Symbol: HHLA3
• Synonyms: HHLA3; HERV-H LTR-associating 3; HERV-H LTR-associating protein 3; human endogenous retrovirus-H long terminal repeat-associating 3; human endogenous retrovirus-H long terminal repeat-associating protein 3
• Gene ID: 11147
• mRNA Refseq: NM_001031693
• Protein Refseq: NP_001026863
• MIM: 604372
• UniProt ID: Q9XRX5