Recombinant Full Length Human HES2 Protein, GST-tagged

• Cat.No.: HES2-3516HF
• Product Overview: Human HES2 full-length ORF ( ENSP00000164269, 1 a.a. - 76 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 76 amino acids
• Description: HES2 (Hes Family BHLH Transcription Factor 2) is a Protein Coding gene. GO annotations related to this gene include transcription factor binding and double-stranded DNA binding. An important paralog of this gene is HES1.
• Molecular Mass: 35 kDa
• AA Sequence: MGLPRRAGDAAELRKSLKPLLEKRRRARINQSLSQLKGLILPLLGREDASGWHTWLPLHAQNCFLLYIQAPEQPPA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HES2 hairy and enhancer of split 2 (Drosophila) [ Homo sapiens ]
• Official Symbol: HES2
• Synonyms: HES2; hairy and enhancer of split 2 (Drosophila); transcription factor HES-2; bHLHb40; class B basic helix-loop-helix protein 40
• Gene ID: 54626
• mRNA Refseq: NM_019089
• Protein Refseq: NP_061962
• MIM: 609970
• UniProt ID: Q9Y543