Recombinant Full Length Human Herpesvirus 6B Protein U33(U33) Protein, His-Tagged
Cat.No. : | RFL2046HF |
Product Overview : | Recombinant Full Length Human herpesvirus 6B Protein U33(U33) Protein (Q9QJ36) (1-470aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human herpesvirus 6B |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-470) |
Form : | Lyophilized powder |
AA Sequence : | MFYLKKLLRQLLAPLCKHGPYTHLQLFVMGDACVPGKCVLTMFLTNKKFLNKEVTEKFYN EFFAIWLRCRPETRFITKRLFNKMVMTKGLFVLLAYLYFVYRQCKVLELLSLYKLKRIKW MDVETRFRVYPSYKLNKLLEMPSFSEINELHMFLFEQQLLLPIPTHVNLPCMRLFCLRDY EQTETVMLRYRQREHVLSFPSMLQKYALKSPAGNFMFTMAKALVENFCFSADRYLIPVEH NNLVPMVPSKPERGDFPKILTFALATSLKDGLATSVISLPVMCYCKTKCSRFILEESYIC VICAKCGHCLNSGKEKLCSPQGFSLSSMFYFRDKQEKNLIYSMHTDVMYCSLCGSQQLVF ERIYEMSEHCVLGMKVETVSWKAVIGTNSACTILNDNVKFDVIVPCSCRSCYSTVHLYNV TVKKLLRLVSHGSDFQCQHCQHSFRETCLDLEDCVNICQGCQISQNVRCI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | U33 |
Synonyms | U33; Protein U33 |
UniProt ID | Q9QJ36 |
◆ Recombinant Proteins | ||
RFC4-292H | Recombinant Human RFC4 Protein, Myc/DDK-tagged | +Inquiry |
CSF2RB-3177H | Active Recombinant Human CSF2RB protein, His-tagged | +Inquiry |
PPP6C-400HF | Recombinant Full Length Human PPP6C Protein | +Inquiry |
MITD1-9856M | Recombinant Mouse MITD1 Protein | +Inquiry |
RFL24990FF | Recombinant Full Length Flavobacterium Johnsoniae Aquaporin Z(Aqpz) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
RBP-94H | Native Human Retinol-Binding Protein | +Inquiry |
Lectin-1801L | Active Native Lycopersicon Esculentum Lectin Protein, Biotinylated | +Inquiry |
LDH3-22H | Active Native Human Lactate Dehydrogenase 3 | +Inquiry |
TF-47C | Native Cattle Transferrin (TRF) Protein | +Inquiry |
Lectin-1751A | Active Native Aleuria Aurantia Lectin Protein, Agarose bound | +Inquiry |
◆ Cell & Tissue Lysates | ||
SUN1-1888HCL | Recombinant Human SUN1 cell lysate | +Inquiry |
DLX1-6908HCL | Recombinant Human DLX1 293 Cell Lysate | +Inquiry |
GLA-1521MCL | Recombinant Mouse GLA cell lysate | +Inquiry |
RGL2-2390HCL | Recombinant Human RGL2 293 Cell Lysate | +Inquiry |
CTNS-7198HCL | Recombinant Human CTNS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All U33 Products
Required fields are marked with *
My Review for All U33 Products
Required fields are marked with *
0
Inquiry Basket