Recombinant Full Length Human Herpesvirus 6B Glycoprotein U20(U20) Protein, His-Tagged
Cat.No. : | RFL30941HF |
Product Overview : | Recombinant Full Length Human herpesvirus 6B Glycoprotein U20(U20) Protein (Q9QJ46) (16-434aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human herpesvirus 6B |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (16-434) |
Form : | Lyophilized powder |
AA Sequence : | LPAKLYIKTTLAEGIGKLQTVIGIDNDIVFAYERLYGDLTLRNHTAVGETLFDLAGSLEE GKNSTVDRFLGHVVIREFHRLHAGLQYVSVQNFSVSELVCFVNNNTQLSGSYVFLARNTT YVQIDLFNENRSFVHDLINVSSFLQNRSLHVLSFYARRFCVEDILNFYGKVVFGDSKYRP PQVFSKRDTGLLVCTARRYRPIGTNIQWSLHNQTVSDDHTTDDFIRTEISGQLLYSYERA LSRALSMTHREFSCEITHKLLVTPALLTREDAFSFKGFVNPVKESEDTFPRHNFPAPHRK KFNKLQLLWIFIVIPIAAGCMFLYILTRYIQFFVSGGSSSNPNRVLKRRRGNDEVPMVIM EVEYCNYEAENHDMELHSVQNVRDDSIAVVCGNNSFDIERQSIKSHESFSNVKLEMLPL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | U20 |
Synonyms | U20; Glycoprotein U20 |
UniProt ID | Q9QJ46 |
◆ Recombinant Proteins | ||
TNFRSF14-1538H | Recombinant Human TNFRSF14 protein, hFc-tagged | +Inquiry |
RFL15208MF | Recombinant Full Length Mycoplasma Hominis Protein Lema(Lema) Protein, His-Tagged | +Inquiry |
C4b-342R | Recombinant Rat C4b Protein, His-tagged | +Inquiry |
CXCL10-1508C | Recombinant Cynomolgus CXCL10 protein, His-tagged | +Inquiry |
SMAGP-5271R | Recombinant Rat SMAGP Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Prothrombin-60H | Native Human Prothrombin Frag 2 | +Inquiry |
IgE-205H | Active Native Human Immunoglobulin E | +Inquiry |
BCHE-5291H | Native Human Butyrylcholinesterase | +Inquiry |
IgY-006D | Native Duck IgY | +Inquiry |
Lectin-1819P | Active Native Phaseolus Vulgaris Erythroagglutinin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
ERO1L-6546HCL | Recombinant Human ERO1L 293 Cell Lysate | +Inquiry |
NME6-3787HCL | Recombinant Human NME6 293 Cell Lysate | +Inquiry |
LCMT1-4803HCL | Recombinant Human LCMT1 293 Cell Lysate | +Inquiry |
PARD6A-3436HCL | Recombinant Human PARD6A 293 Cell Lysate | +Inquiry |
ALDH3A2-8917HCL | Recombinant Human ALDH3A2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All U20 Products
Required fields are marked with *
My Review for All U20 Products
Required fields are marked with *
0
Inquiry Basket