Recombinant Full Length Human Herpesvirus 6A Uncharacterized Protein U15(U15) Protein, His-Tagged
Cat.No. : | RFL34353HF |
Product Overview : | Recombinant Full Length Human herpesvirus 6A Uncharacterized protein U15(U15) Protein (Q69550) (1-110aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human Herpesvirus 6A |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-110) |
Form : | Lyophilized powder |
AA Sequence : | MDVWKRQRLQECRELCPLPVLMSLSNMFSKIEIVYVKYLFKMDFSTMYRYILPALTLSMT VTKSLVIEMLFILKRWEDIDQFFRLNIRKVNDCFIVAQFNHIPIKRWVLI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | U15 |
Synonyms | U15; EFLF3; Uncharacterized protein U15 |
UniProt ID | Q69550 |
◆ Recombinant Proteins | ||
TMEM28-17029M | Recombinant Mouse TMEM28 Protein | +Inquiry |
LYRM4-1777H | Recombinant Human LYRM4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
RFL16832SF | Recombinant Full Length Salmonella Choleraesuis Atp Synthase Subunit B(Atpf) Protein, His-Tagged | +Inquiry |
NDUFAB1A-871Z | Recombinant Zebrafish NDUFAB1A | +Inquiry |
YPBD-3310B | Recombinant Bacillus subtilis YPBD protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Fibrin-001H | Native Human Fibrin Protein | +Inquiry |
CRP-8056H | Native Human C-Reactive Protein | +Inquiry |
Lectin-1868W | Active Native Wisteria Floribunda Lectin Protein, Agarose bound | +Inquiry |
PNLIP-1175P | Native Porcine Pancreatic Lipase | +Inquiry |
Lectin-1830R | Active Native Ricinus Communis Agglutinin I Protein, Agarose bound | +Inquiry |
◆ Cell & Tissue Lysates | ||
Thyroid-501C | Chicken Thyroid Lysate, Total Protein | +Inquiry |
NFIA-3853HCL | Recombinant Human NFIA 293 Cell Lysate | +Inquiry |
PPIL6-2965HCL | Recombinant Human PPIL6 293 Cell Lysate | +Inquiry |
CAMK2D-7879HCL | Recombinant Human CAMK2D 293 Cell Lysate | +Inquiry |
ST6GAL2-1703HCL | Recombinant Human ST6GAL2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All U15 Products
Required fields are marked with *
My Review for All U15 Products
Required fields are marked with *
0
Inquiry Basket