Recombinant Full Length Human Herpesvirus 2 Envelope Glycoprotein D(Gd) Protein, His-Tagged
Cat.No. : | RFL18840HF |
Product Overview : | Recombinant Full Length Human herpesvirus 2 Envelope glycoprotein D(gD) Protein (Q69467) (26-393aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human herpesvirus 2 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (26-393) |
Form : | Lyophilized powder |
AA Sequence : | KYALADPSLKMADPNRFRGKNLPVLDQLTDPPGVKRVYHIQPSLEDPFQPPSIPITVYYA VLERACRSVLLHAPSEAPQIVRGASDEARKHTYNLTIAWYRMGDNCAIPITVMEYTECPY NKSLGVCPIRTQPRWSYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFI LEHRARASCKYALPLRIPPAACLTSKAYQQGVTVDSIGMLPRFIPENQRTVALYSLKIAG WHGPKPPYTSTLLPPELSDTTNATQPELVPEDPEDSALLEDPAGTVSSQIPPNWHIPSIQ DVAPHHAPAAPSNPGLIIGALAGSTLAVLVIGGIAFWVRRRAQMAPKRLRLPHIRDDDAP PSHQPLFY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | gD |
Synonyms | gD; US6; Envelope glycoprotein D; gD |
UniProt ID | Q69467 |
◆ Recombinant Proteins | ||
ASB6-895H | Recombinant Human ASB6 protein, GST-tagged | +Inquiry |
DCXR-3334H | Recombinant Human DCXR protein, His-SUMO-tagged | +Inquiry |
DUSP6-5925C | Recombinant Chicken DUSP6 | +Inquiry |
POLR1C-10846Z | Recombinant Zebrafish POLR1C | +Inquiry |
Fkbp2-3025M | Recombinant Mouse Fkbp2 Protein, Myc/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
IgG4-232H | Native Human Immunoglobulin G4 (IgG4) | +Inquiry |
Testis-022H | Human Testis Lysate, Total Protein | +Inquiry |
HDL-1539H | Native Human High-density lipoprotein | +Inquiry |
AMY1B-31376TH | Native Human AMY1B | +Inquiry |
IgG-340G | Native Goat IgG | +Inquiry |
◆ Cell & Tissue Lysates | ||
SEC23B-1993HCL | Recombinant Human SEC23B 293 Cell Lysate | +Inquiry |
CYP2S1-7108HCL | Recombinant Human CYP2S1 293 Cell Lysate | +Inquiry |
PDCL-3357HCL | Recombinant Human PDCL 293 Cell Lysate | +Inquiry |
PDLIM4-1325HCL | Recombinant Human PDLIM4 cell lysate | +Inquiry |
TREM2-2186MCL | Recombinant Mouse TREM2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All gD Products
Required fields are marked with *
My Review for All gD Products
Required fields are marked with *
0
Inquiry Basket