Recombinant Full Length Cercopithecine Herpesvirus 1 Envelope Glycoprotein D(Gd) Protein, His-Tagged
Cat.No. : | RFL32156CF |
Product Overview : | Recombinant Full Length Cercopithecine herpesvirus 1 Envelope glycoprotein D(gD) Protein (P36342) (18-395aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Cercopithecine herpesvirus 1 (CeHV-1) (Simian herpes B virus) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (18-395) |
Form : | Lyophilized powder |
AA Sequence : | RVPAGEGEYVPVERSLTRVNPGRFRGAHLPPLEQKTDPPDVRRVYHVQPFVENPFQTPSV PVAVYYAVLERACRSVLLWAPTEAVQVVRGAPEATRSDARYNLTVAWYRTSDDCAIPILV MEYAECQYDKPLGACPVRNLPRWSFYDSFSATGDDDLGLLMHAPAFETAGTYVRLVKVNG WVEVTQFIFEHRGKGPCRYTLPLRILPAACLRAPVFEQGVTVDAIGMLPRFIPENQRIVA VYSLQAAGWHGPKAPFTSTLLPPEVVETANVTRPELAPEERGTSRTPGDEPAPAVAAQLP PNWHVPEASDVTIQGPAPAPSGHTGAVVGALAGAGLAAGVVVLAVYLVRRRGRAAGKHVR LPELLEEAHGPARRGAPY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | gD |
Synonyms | gD; Envelope glycoprotein D; gD |
UniProt ID | P36342 |
◆ Recombinant Proteins | ||
VPS52-18383M | Recombinant Mouse VPS52 Protein | +Inquiry |
Guanine-4471S | Recombinant Soybean Guanine protein, His-SUMO-tagged | +Inquiry |
CALML3-0306H | Recombinant Human CALML3 Protein, GST-Tagged | +Inquiry |
SH-RS04780-5845S | Recombinant Staphylococcus haemolyticus JCSC1435 SH_RS04780 protein, His-tagged | +Inquiry |
LRRC2-2689H | Recombinant Human LRRC2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
CRP-8056H | Native Human C-Reactive Protein | +Inquiry |
Collagen-318B | Native Bovine Collagen Type IV | +Inquiry |
IgG-152R | Native Rat IgG Fab fragment | +Inquiry |
Envelope-776W | Native purified West Nile Virus Envelope (E) Protein, His-tagged | +Inquiry |
A1AGP-01P | Native Porcine A1AGP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
NEDD9-1182HCL | Recombinant Human NEDD9 cell lysate | +Inquiry |
ODC1-3600HCL | Recombinant Human ODC1 293 Cell Lysate | +Inquiry |
PRTN3-2797HCL | Recombinant Human PRTN3 293 Cell Lysate | +Inquiry |
CCNB1-303HCL | Recombinant Human CCNB1 cell lysate | +Inquiry |
TBCCD1-1217HCL | Recombinant Human TBCCD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All gD Products
Required fields are marked with *
My Review for All gD Products
Required fields are marked with *
0
Inquiry Basket