Recombinant Full Length Human Herpesvirus 1 Envelope Glycoprotein I(Gi) Protein, His-Tagged
Cat.No. : | RFL29853HF |
Product Overview : | Recombinant Full Length Human herpesvirus 1 Envelope glycoprotein I(gI) Protein (P06487) (21-390aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human Herpesvirus 1 |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (21-390) |
Form : | Lyophilized powder |
AA Sequence : | LVVRGPTVSLVSNSFVDAGALGPDGVVEEDLLILGELRFVGDQVPHTTYYDGGVELWHYP MGHKCPRVVHVVTVTACPRRPAVAFALCRATDSTHSPAYPTLELNLAQQPLLRVQRATRD YAGVYVLRVWVGDAPNASLFVLGMAIAAEGTLAYNGSAYGSCDPKLLPSSAPRLAPASVY QPAPNQASTPSTTTSTPSTTIPAPSTTIPAPQASTTPFPTGDPKPQPPGVNHEPPSNATR ATRDSRYALTVTQIIQIAIPASIIALVFLGSCICFIHRCQRRYRRSRRPIYSPQMPTGIS CAVNEAAMARLGAELKSHPSTPPKSRRRSSRTPMPSLTAIAEESEPAGAAGLPTPPVDPT TPTPTPPLLV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | gI |
Synonyms | gI; US7; Envelope glycoprotein I; gI |
UniProt ID | P06487 |
◆ Recombinant Proteins | ||
NUPR1-3794R | Recombinant Rat NUPR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CROT-3323H | Recombinant Human CROT Protein, MYC/DDK-tagged | +Inquiry |
CHKA-3986Z | Recombinant Zebrafish CHKA | +Inquiry |
FAM103A1-1550R | Recombinant Rhesus monkey FAM103A1 Protein, His-tagged | +Inquiry |
KRTAP3-2-4814H | Recombinant Human KRTAP3-2 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
IgG-333T | Native Turkey IgG | +Inquiry |
TSH-1312B | Active Native Bovine TSH Protein | +Inquiry |
Pa-27F | Native Feline Parvovirus Antigen | +Inquiry |
IgA-238R | Native Rabbit Immunoglobulin A | +Inquiry |
REN-388H | Active Native Human Renin Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
Liver-278C | Cynomolgus monkey Liver (LT Lobe) Lysate | +Inquiry |
Ovary-354C | Cynomolgus monkey Ovary Membrane Lysate | +Inquiry |
CSNK1G3-7238HCL | Recombinant Human CSNK1G3 293 Cell Lysate | +Inquiry |
PPHLN1-2976HCL | Recombinant Human PPHLN1 293 Cell Lysate | +Inquiry |
TACC3-1285HCL | Recombinant Human TACC3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All gI Products
Required fields are marked with *
My Review for All gI Products
Required fields are marked with *
0
Inquiry Basket