Recombinant Full Length Human HBE1 Protein, GST-tagged

• Cat.No.: HBE1-3492HF
• Product Overview: Human HBE1 full-length ORF ( AAH15537, 1 a.a. - 147 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The epsilon globin gene (HBE) is normally expressed in the embryonic yolk sac: two epsilon chains together with two zeta chains (an alpha-like globin) constitute the embryonic hemoglobin Hb Gower I; two epsilon chains together with two alpha chains form the embryonic Hb Gower II. Both of these embryonic hemoglobins are normally supplanted by fetal, and later, adult hemoglobin. The five beta-like globin genes are found within a 45 kb cluster on chromosome 11 in the following order: 5-epsilon - G-gamma - A-gamma - delta - beta-3 [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 41.69 kDa
• Protein length: 147 amino acids
• AA Sequence: MVHFTAEEKAAVTSLWSKMNVEEAGGEALGRLLVVYPWTQRFFDSFGNLSSPSAILGNPKVKAHGKKVLTSFGDAIKNMDNLKPAFAKLSELHCDKLHVDPENFKLLGNVMVIILATHFGKEFTPEVQAAWQKLVSAVAIALAHKYH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HBE1 hemoglobin subunit epsilon 1 [ Homo sapiens (human) ]
• Official Symbol: HBE1
• Synonyms: HBE1; hemoglobin subunit epsilon 1; HBE; hemoglobin subunit epsilon; epsilon globin; hemoglobin epsilon chain; hemoglobin, epsilon 1
• Gene ID: 3046
• mRNA Refseq: NM_005330
• Protein Refseq: NP_005321
• MIM: 142100
• UniProt ID: P02100