Recombinant Full Length Human HAND2 Protein, GST-tagged

• Cat.No.: HAND2-3350HF
• Product Overview: Human HAND2 full-length ORF ( AAI01407.1, 1 a.a. - 180 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene belongs to the basic helix-loop-helix family of transcription factors. This gene product is one of two closely related family members, the HAND proteins, which are asymmetrically expressed in the developing ventricular chambers and play an essential role in cardiac morphogenesis. Working in a complementary fashion, they function in the formation of the right ventricle and aortic arch arteries, implicating them as mediators of congenital heart disease. In addition, this transcription factor plays an important role in limb and branchial arch development. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 46.7 kDa
• Protein length: 180 amino acids
• AA Sequence: MSLVGGFPHHPVVHHEGYPFAAAAAASRCSHEENPYFHGWLIGHPEMSPPDYSMALSYSPEYASGTANRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELKQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HAND2 heart and neural crest derivatives expressed 2 [ Homo sapiens ]
• Official Symbol: HAND2
• Synonyms: HAND2; heart and neural crest derivatives expressed 2; heart- and neural crest derivatives-expressed protein 2; bHLHa26; dHand; Hed; Thing2; class A basic helix-loop-helix protein 26; basic helix-loop-helix transcription factor HAND2; deciduum, heart, autonomic nervous system and neural crest derivatives-expressed protein 2; DHAND2; FLJ16260; MGC125303; MGC125304
• Gene ID: 9464
• mRNA Refseq: NM_021973
• Protein Refseq: NP_068808
• MIM: 602407
• UniProt ID: P61296