Recombinant Full Length Human HAGHL Protein, GST-tagged

• Cat.No.: HAGHL-3449HF
• Product Overview: Human HAGHL full-length ORF ( AAH15008.1, 1 a.a. - 203 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 203 amino acids
• Description: HAGHL (Hydroxyacylglutathione Hydrolase-Like) is a Protein Coding gene. GO annotations related to this gene include hydrolase activity and hydroxyacylglutathione hydrolase activity. An important paralog of this gene is HAGH.
• Molecular Mass: 48.5 kDa
• AA Sequence: MKVKVIPVLEDNYMYLVIEELTREAVAVDVAVPKRLLEIVGREGVSLTAVLTTHHHWDHARGNPELARLRPGLAVLGADERIFSLTRRLAHGEELRVSARSREGRGGRPGSTRPHRSACSSAAVRGHPRALPPDARPHRRPHELLPVGGRLPGPTRPVLGRRAVGGRLRLVPGGQRPADVPEPGRAGYPAPRDEGVLRPRAHA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HAGHL hydroxyacylglutathione hydrolase-like [ Homo sapiens ]
• Official Symbol: HAGHL
• Synonyms: HAGHL; hydroxyacylglutathione hydrolase-like; hydroxyacyl glutathione hydrolase like; hydroxyacylglutathione hydrolase-like protein; MGC2605; GLO2-like/ RJD12
• Gene ID: 84264
• mRNA Refseq: NM_032304
• Protein Refseq: NP_115680
• UniProt ID: Q6PII5