Recombinant Full Length Human H1FOO Protein, GST-tagged

• Cat.No.: H1FOO-3396HF
• Product Overview: Human H1FOO full-length ORF ( AAH47943.1, 1 a.a. - 207 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Nucleosomes consist of approximately 146 bp of DNA wrapped around a histone octamer composed of pairs of each of the four core histones (H2A, H2B, H3, and H4). The chromatin fiber is further compacted through the interaction of a linker histone, H1, with the DNA between the nucleosomes to form higher order chromatin structures. The protein encoded is a replication-independent histone that is a member of the histone H1 family. This gene contains introns, unlike most histone genes. The related mouse gene is expressed only in oocytes. [provided by RefSeq, Oct 2015]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 47.4 kDa
• Protein length: 207 amino acids
• AA Sequence: MAPATAPRRAGEAKGKGPKKPSEAKEDPPNVGKVKKAAKRPAKVQKPPPKPGAATEKARKQGGAAKDTRAQSGEARKVPPKPDKAMRAPSSAGGLSRKAKAKGSRSSQGDAEAYRKTKAESKSSKPTASKVKNGAASPTKKKVVAKAKAPKAGQGPNTKAAAPAKGSGSKVVPAHLSRKTEAPKGPRKAGLPIKASSSKVSSQRAEA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: H1FOO H1 histone family member O oocyte specific [ Homo sapiens (human) ]
• Official Symbol: H1FOO
• Synonyms: H1 Histone Family Member O, Oocyte Specific; Oocyte-Specific Linker Histone H1; Oocyte-Specific Histone H1; H1oo; OsH1; H1 Histone Family, Member O, Oocyte-Specific; Histone H1oo; H1.8; H1FOO; H1 histone family member O oocyte specific; histone H1oo; oocyte-specific histone H1; oocyte-specific linker histone H1
• Gene ID: 132243
• mRNA Refseq: NM_001308262
• Protein Refseq: NP_001295191
• UniProt ID: Q8IZA3