Recombinant Full Length Human GZMM Protein, GST-tagged

Cat.No. : GZMM-3394HF
Product Overview : Human GZMM full-length ORF ( AAH25701.1, 1 a.a. - 257 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 257 amino acids
Description : Human natural killer (NK) cells and activated lymphocytes express and store a distinct subset of neutral serine proteases together with proteoglycans and other immune effector molecules in large cytoplasmic granules. These serine proteases are collectively termed granzymes and include 4 distinct gene products: granzyme A, granzyme B, granzyme H, and Met-ase, also known as granzyme M. [provided by RefSeq
Molecular Mass : 54.01 kDa
AA Sequence : MEACVSSLLVLALGALSVGSSFGTQIIGGREVIPHSRPYMASLQRNGSHLCGGVLVHPKWVLTAAHCLAQRMAQLRLVLGLHTLDSPGLTFHIKAAIQHPRYKPVPALENDLALLQLDGKVKPSRTIRPLALPSKRQVVAAGTRCSMAGWGLTHQGGRLSRVLRELDLQVLDTRMCNNSRFWNGSLSPSMVCLAADSKDQAPCKGDSGGPLVCGKGRVLAGVLSFSSRVCTDIFKPPVATAVAPYVSWIRKVTGRSA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GZMM granzyme M (lymphocyte met-ase 1) [ Homo sapiens ]
Official Symbol GZMM
Synonyms GZMM; granzyme M (lymphocyte met-ase 1); granzyme M; LMET1; lymphocyte met ase 1; MET1; met-ase; HU-Met-1; lymphocyte met-ase 1; Met-1 serine protease; natural killer cell granular protease;
Gene ID 3004
mRNA Refseq NM_005317
Protein Refseq NP_005308
MIM 600311
UniProt ID P51124

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GZMM Products

Required fields are marked with *

My Review for All GZMM Products

Required fields are marked with *

0

Inquiry Basket

cartIcon