Recombinant Full Length Human GXYLT1 Protein, GST-tagged
Cat.No. : | GXYLT1-5355HF |
Product Overview : | Human GLT8D3 full-length ORF ( AAH39145.1, 1 a.a. - 409 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 409 amino acids |
Description : | GXYLT1 is a xylosyltransferase (EC 2.4.2.-) that adds the first xylose to O-glucose-modified residues in the epidermal growth factor (EGF; MIM 131530) repeats of proteins such as NOTCH1 (MIM 190198) (Sethi et al., 2010 [PubMed 19940119]).[supplied by OMIM, Mar 2010] |
Molecular Mass : | 73.2 kDa |
AA Sequence : | MRRYLRVVVLCVACGFCSLLYAFSQLAVSLEEGTGGGGGKPQAAVASWLAGGGRGAVRGAGVAGPAAHPGVSDRYSLKIQPVEKMHLAVVACGERLEETMTMLKSAIIFSIKPLQFHIFAEDQLHHSFKGRLDNWSFLQTFNYTLYPITFPSENAAEWKKLFKPCASQRLFLPLILKEVDSLLYVDTDILFLRPVDDIWSLLKKFNSTQIAAMAPEHEEPRIGWYNRFARHPYYGKTGVNSGVMLMNMTRMRRKYFKNDMTTVRLQWGDILMPLLKKYKLNITWGDQDLLNIVFFHNPESLFVFPCQWNYRPDHCIYGSNCQEAEEGGIFILHGNRGVYHDDKQPAFRAVYEALRNCSFEDDNIRSLLKPLELELQKTVHTYCGKIYKIFIKQLAKSVRDRYARSPKEK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GXYLT1 glucoside xylosyltransferase 1 [ Homo sapiens (human) ] |
Official Symbol | GXYLT1 |
Synonyms | GXYLT1; glucoside xylosyltransferase 1; GLT8D3; glucoside xylosyltransferase 1; glycosyltransferase 8 domain containing 3; glycosyltransferase 8 domain-containing protein 3; NP_001093120.1; EC 2.4.2.n2 |
Gene ID | 283464 |
mRNA Refseq | NM_001099650 |
Protein Refseq | NP_001093120 |
MIM | 613321 |
UniProt ID | Q4G148 |
◆ Recombinant Proteins | ||
GXYLT1-2764R | Recombinant Rat GXYLT1 Protein | +Inquiry |
GXYLT1-5355HF | Recombinant Full Length Human GXYLT1 Protein, GST-tagged | +Inquiry |
GXYLT1-4017M | Recombinant Mouse GXYLT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
GXYLT1-4986H | Recombinant Human GXYLT1 Protein, GST-tagged | +Inquiry |
GXYLT1-2021R | Recombinant Rhesus monkey GXYLT1 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GXYLT1 Products
Required fields are marked with *
My Review for All GXYLT1 Products
Required fields are marked with *
0
Inquiry Basket