Recombinant Full Length Human GXYLT1 Protein, GST-tagged

• Cat.No.: GXYLT1-5355HF
• Product Overview: Human GLT8D3 full-length ORF ( AAH39145.1, 1 a.a. - 409 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: GXYLT1 is a xylosyltransferase (EC 2.4.2.-) that adds the first xylose to O-glucose-modified residues in the epidermal growth factor (EGF; MIM 131530) repeats of proteins such as NOTCH1 (MIM 190198) (Sethi et al., 2010 [PubMed 19940119]).[supplied by OMIM, Mar 2010]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 73.2 kDa
• Protein length: 409 amino acids
• AA Sequence: MRRYLRVVVLCVACGFCSLLYAFSQLAVSLEEGTGGGGGKPQAAVASWLAGGGRGAVRGAGVAGPAAHPGVSDRYSLKIQPVEKMHLAVVACGERLEETMTMLKSAIIFSIKPLQFHIFAEDQLHHSFKGRLDNWSFLQTFNYTLYPITFPSENAAEWKKLFKPCASQRLFLPLILKEVDSLLYVDTDILFLRPVDDIWSLLKKFNSTQIAAMAPEHEEPRIGWYNRFARHPYYGKTGVNSGVMLMNMTRMRRKYFKNDMTTVRLQWGDILMPLLKKYKLNITWGDQDLLNIVFFHNPESLFVFPCQWNYRPDHCIYGSNCQEAEEGGIFILHGNRGVYHDDKQPAFRAVYEALRNCSFEDDNIRSLLKPLELELQKTVHTYCGKIYKIFIKQLAKSVRDRYARSPKEK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GXYLT1 glucoside xylosyltransferase 1 [ Homo sapiens (human) ]
• Official Symbol: GXYLT1
• Synonyms: GXYLT1; glucoside xylosyltransferase 1; GLT8D3; glucoside xylosyltransferase 1; glycosyltransferase 8 domain containing 3; glycosyltransferase 8 domain-containing protein 3; NP_001093120.1; EC 2.4.2.n2
• Gene ID: 283464
• mRNA Refseq: NM_001099650
• Protein Refseq: NP_001093120
• MIM: 613321
• UniProt ID: Q4G148