Recombinant Full Length Human GULP1 Protein, GST-tagged

• Cat.No.: GULP1-3353HF
• Product Overview: Human GULP1 full-length ORF ( AAH01103.1, 1 a.a. - 167 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 167 amino acids
• Description: The prompt clearance of cells undergoing apoptosis is critical during embryonic development, normal tissue turnover, inflammation, and autoimmunity. CED6 is an evolutionarily conserved adaptor protein required for efficient engulfment of apoptotic cells by phagocytes.[supplied by OMIM
• Molecular Mass: 45.8 kDa
• AA Sequence: MNRAFSRKKDKTWMHTPEALSKHFIPYNAKFLGSTEVEQPKGTEVVRDAVRKLKFARHIKKSEGQKIPKVELQISIYGVKILEPKTKEVQHNCQLHRISFCADDKTDKRIFTFICKDSESNKHLCYVFDSEKCVSIPDVVGWFVLFYKPGIVLLLALAKYLKMNNFL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GULP1 GULP, engulfment adaptor PTB domain containing 1 [ Homo sapiens ]
• Official Symbol: GULP1
• Synonyms: GULP1; GULP, engulfment adaptor PTB domain containing 1; PTB domain-containing engulfment adapter protein 1; CED 6; CED6; GULP; engulfment adapter protein; cell death protein 6 homolog; PTB domain adapter protein CED-6; PTB domain adaptor protein CED-6; CED-6; FLJ31156
• Gene ID: 51454
• mRNA Refseq: NM_001252668
• Protein Refseq: NP_001239597
• MIM: 608165
• UniProt ID: Q9UBP9