Recombinant Full Length Human GUCA2A Protein, GST-tagged

• Cat.No.: GUCA2A-3342HF
• Product Overview: Human GUCA2A full-length ORF ( NP_291031.2, 1 a.a. - 115 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 115 amino acids
• Description: GUCA2A (Guanylate Cyclase Activator 2A) is a Protein Coding gene. Diseases associated with GUCA2A include Cone-Rod Dystrophy and Cystic Fibrosis. Among its related pathways are Miscellaneous digestion events and Myometrial Relaxation and Contraction Pathways. GO annotations related to this gene include hormone activity and guanylate cyclase activator activity.
• Molecular Mass: 38.8 kDa
• AA Sequence: MNAFLLSALCLLGAWAALAGGVTVQDGNFSFSLESVKKLKDLQEPQEPRVGKLRNFAPIPGEPVVPILCSNPNFPEELKPLCKEPNAQEILQRLEEIAEDPGTCEICAYAACTGC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GUCA2A guanylate cyclase activator 2A (guanylin) [ Homo sapiens ]
• Official Symbol: GUCA2A
• Synonyms: GUCA2A; guanylate cyclase activator 2A (guanylin); GUCA2; guanylin; STARA; guanylate cyclase-activating protein 1; guanylate cyclase-activating protein I; guanylate cyclase activator 2A (guanylin 2, intestinal, heat-stable); GCAP-I
• Gene ID: 2980
• mRNA Refseq: NM_033553
• Protein Refseq: NP_291031
• MIM: 139392
• UniProt ID: Q02747