Recombinant Full Length Human GUCA1C Protein, GST-tagged

Cat.No. : GUCA1C-3341HF
Product Overview : Human GUCA1C full-length ORF ( NP_005450.2, 1 a.a. - 209 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : GUCA1C (Guanylate Cyclase Activator 1C) is a Protein Coding gene. Among its related pathways are Metabolism of fat-soluble vitamins and Phototransduction. GO annotations related to this gene include calcium ion binding and calcium sensitive guanylate cyclase activator activity. An important paralog of this gene is GUCA1A.
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 50.2 kDa
Protein length : 209 amino acids
AA Sequence : MGNGKSIAGDQKAVPTQETHVWYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQVYNTFDTNKDGFIDFLEFIAAVNLIMQEKMEQKLKWYFKLYDADGNGSIDKNELLDMFMAVQALNGQQTLSPEEFINLVFHKIDINNDGELTLEEFINGMAKDQDLLEIVYKSFDFSNVLRVICNGKQPDMETDSSKSPDKAGLGKVKMK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GUCA1C guanylate cyclase activator 1C [ Homo sapiens ]
Official Symbol GUCA1C
Synonyms GUCA1C; guanylate cyclase activator 1C; guanylyl cyclase-activating protein 3; GCAP3; guanylyl cyclase activating protein 3; GCAP 3; MGC120158; MGC120159;
Gene ID 9626
mRNA Refseq NM_005459
Protein Refseq NP_005450
MIM 605128
UniProt ID O95843

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GUCA1C Products

Required fields are marked with *

My Review for All GUCA1C Products

Required fields are marked with *

0

Inquiry Basket

cartIcon