Recombinant Full Length Human GUCA1C Protein, GST-tagged

• Cat.No.: GUCA1C-3341HF
• Product Overview: Human GUCA1C full-length ORF ( NP_005450.2, 1 a.a. - 209 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: GUCA1C (Guanylate Cyclase Activator 1C) is a Protein Coding gene. Among its related pathways are Metabolism of fat-soluble vitamins and Phototransduction. GO annotations related to this gene include calcium ion binding and calcium sensitive guanylate cyclase activator activity. An important paralog of this gene is GUCA1A.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 50.2 kDa
• Protein length: 209 amino acids
• AA Sequence: MGNGKSIAGDQKAVPTQETHVWYRTFMMEYPSGLQTLHEFKTLLGLQGLNQKANKHIDQVYNTFDTNKDGFIDFLEFIAAVNLIMQEKMEQKLKWYFKLYDADGNGSIDKNELLDMFMAVQALNGQQTLSPEEFINLVFHKIDINNDGELTLEEFINGMAKDQDLLEIVYKSFDFSNVLRVICNGKQPDMETDSSKSPDKAGLGKVKMK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GUCA1C guanylate cyclase activator 1C [ Homo sapiens ]
• Official Symbol: GUCA1C
• Synonyms: GUCA1C; guanylate cyclase activator 1C; guanylyl cyclase-activating protein 3; GCAP3; guanylyl cyclase activating protein 3; GCAP 3; MGC120158; MGC120159
• Gene ID: 9626
• mRNA Refseq: NM_005459
• Protein Refseq: NP_005450
• MIM: 605128
• UniProt ID: O95843