Recombinant Full Length Human GTPBP5 Protein, GST-tagged

• Cat.No.: GTPBP5-3426HF
• Product Overview: Human GTPBP5 full-length ORF ( NP_056481.1, 1 a.a. - 406 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 406 amino acids
• Description: Small G proteins, such as GTPBP5, act as molecular switches that play crucial roles in the regulation of fundamental cellular processes such as protein synthesis, nuclear transport, membrane trafficking, and signal transduction (Hirano et al., 2006 [PubMed 17054726]).[supplied by OMIM
• Molecular Mass: 70.4 kDa
• AA Sequence: MAPARCFSARLRTVFQGVGHWALSTWAGLKPSRLLPQRASPRLLSVGRADLAKHQELPGKKLLSEKKLKRYFVDYRRVLVCGGNGGAGASCFHSEPRKEFGGPDGGDGGNGGHVILRVDQQVKSLSSVLSRYQGFSGEDGGSKNCFGRSGAVLYIRVPVGTLVKEGGRVVADLSCVGDEYIAALGGAGGKGNRFFLANNNRAPVTCTPGQPGQQRVLHLELKTVAHAGMVGFPNAGKSSLLRAISNARPAVASYPFTTLKPHVGIVHYEGHLQIAVADIPGIIRGAHQNRGLGSAFLRHIERCRFLLFVVDLSQPEPWTQVDDLKYELEMYEKGLSARPHAIVANKIDLPEAQANLSQLRDHLGQEVIVLSALTGENLEQLLLHLKVLYDAYAEAELGQGRQPLRW
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GTPBP5 GTP binding protein 5 (putative) [ Homo sapiens ]
• Official Symbol: GTPBP5
• Synonyms: GTPBP5; GTP binding protein 5 (putative); GTP-binding protein 5; dJ1005F21.2; FLJ10741; ObgH1; protein obg homolog 1; GTP-binding protein 5 (putative); MGC29512
• Gene ID: 26164
• mRNA Refseq: NM_015666
• Protein Refseq: NP_056481
• MIM: 610919
• UniProt ID: Q9H4K7