Recombinant Full Length Human GTPBP10 Protein, GST-tagged

• Cat.No.: GTPBP10-3422HF
• Product Overview: Human GTPBP10 full-length ORF (BAC04573.1, 1 a.a. - 387 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: Small G proteins, such as GTPBP10, act as molecular switches that play crucial roles in the regulation of fundamental cellular processes such as protein synthesis, nuclear transport, membrane trafficking, and signal transduction (Hirano et al., 2006 [PubMed 17054726]).[supplied by OMIM
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 69.4 kDa
• Protein length: 387 amino acids
• AA Sequence: MVHCSCVLFRKYGNFIDKLRLFTRGGSGGMGYPRLGGEGGKGGDVWVVAQNRMTLKQLKDRYPRKRFVAGVGANSKISALKGSKGKDWEIPVPVGISVTDENGKIIGELNKENDRILVAQGGLGGKLLTNFLPLKGQKRIIHLDLKLIADVGLVGFPNAGKSSLLSCVSHAKPAIADYAFTTLKPELGKIMYSDFKQISVADLPGLIEGAHMNKGMGHKFLKHIERTRQLLFVVDISGFQLSSHTQYRTAFETIILLTKELELYKEELQTKPALLAVNKMDLPDAQDKFHELMSQLQNPKDFLHLFEKNMIPERTVEFQHIIPISAVTGEGIEELKNCIRKSLDEQANQENDALHKKQLLNLWISDTMSSTEPPSKHAVTTSKMDII
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GTPBP10 GTP-binding protein 10 (putative) [ Homo sapiens ]
• Official Symbol: GTPBP10
• Synonyms: GTPBP10; GTP-binding protein 10 (putative); GTP-binding protein 10; DKFZP686A10121; FLJ38242; protein obg homolog 2; ObgH2; UG0751c10; MGC104191; DKFZp686A10121
• Gene ID: 85865
• mRNA Refseq: NM_001042717
• Protein Refseq: NP_001036182
• MIM: 610920
• UniProt ID: A4D1E9