Recombinant Full Length Human GTF3C6 Protein, GST-tagged

• Cat.No.: GTF3C6-3419HF
• Product Overview: Human GTF3C6 full-length ORF ( NP_612417.1, 1 a.a. - 213 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 213 amino acids
• Description: RNA polymerases are unable to initiate RNA synthesis in the absence of additional proteins called general transcription factors (GTFs). GTFs assemble in a complex on the DNA promoter and recruit the RNA polymerase. GTF3C family proteins (e.g., GTF3C1, MIM 603246) are essential for RNA polymerase III to make a number of small nuclear and cytoplasmic RNAs, including 5S RNA (MIM 180420), tRNA, and adenovirus-associated (VA) RNA of both cellular and viral origin.[supplied by OMIM
• Molecular Mass: 50.4 kDa
• AA Sequence: MAAAADERSPEDGEDEEEEEQLVLVELSGIIDSDFLSKCENKCKVLGIDTERPILQVDSCVFAGEYEDTLGTCVIFEENVEHADTEGNNKTVLKYKCHTMKKLSMTRTLLTEKKEGEENIGGVEWLQIKDNDFSYRPNMICNFLHENEDEEVVASAPDKSLELEEEEIQMNDSSNLSCEQEKPMHLEIEDSGPLIDIPSETEGSVFMETQMLP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GTF3C6 general transcription factor IIIC, polypeptide 6, alpha 35kDa [ Homo sapiens ]
• Official Symbol: GTF3C6
• Synonyms: GTF3C6; general transcription factor IIIC, polypeptide 6, alpha 35kDa; C6orf51, chromosome 6 open reading frame 51; general transcription factor 3C polypeptide 6; bA397G5.3; TFIIIC35; TFIIIC 35 kDa subunit; transcription factor IIIC 35kDa; transcription factor IIIC subunit 6; transcription factor IIIC 35 kDa subunit; C6orf51
• Gene ID: 112495
• mRNA Refseq: NM_138408
• Protein Refseq: NP_612417
• MIM: 611784
• UniProt ID: Q969F1