Recombinant Full Length Human GTF2I Protein

Cat.No. : GTF2I-214HF
Product Overview : Recombinant full length Human TFII I, amino acids 1-274 according to AAH04472, with N terminal proprietary tag; predicted MW: 55.88 kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 274 amino acids
Description : This gene encodes a multifunctional phosphoprotein with roles in transcription and signal transduction. It is deleted in Williams-Beuren syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at chromosome 7q11.23. Alternative splicing results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 7, 13 and 21.
Form : Liquid
Molecular Mass : 55.880kDa inclusive of tags
AA Sequence : MAQVAMSTLPVEDEESSESRMVVTFLMSALESMCKELAKS KAEVACIAVYETDVFVVGTERGRAFVNTRKDFQKDFVKYC VEEEEKAAEMHKMKSTTQANRMSVDAVEIETLRKTVEDYF CFCYGKALGKSTVVPVPYEKMLRDQSAVVVQGLPEGVAFK HPENYDLATLKWILENKAGVSFIIKRPFLEPKKHVGGRVM VTDADRSILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVK EESEDPDYYQYNIQGSHHSSEGNEGTEMEVPAEG
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name GTF2I general transcription factor IIi [ Homo sapiens ]
Official Symbol GTF2I
Synonyms GTF2I; general transcription factor IIi; general transcription factor II, i , WBSCR6; general transcription factor II-I; BAP 135; BTKAP1; DIWS; IB291; SPIN; TFII I
Gene ID 2969
mRNA Refseq NM_001163636
Protein Refseq NP_001157108
MIM 601679
UniProt ID P78347

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GTF2I Products

Required fields are marked with *

My Review for All GTF2I Products

Required fields are marked with *

0

Inquiry Basket

cartIcon