Recombinant Full Length Human GSTA3 Protein

Cat.No. : GSTA3-212HF
Product Overview : Recombinant full length Human GSTA3 with N terminal proprietary tag. Predicted MW 50.53 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 222 amino acids
Description : Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-tranferase belonging to the alpha class genes that are located in a cluster mapped to chromosome 6. Genes of the alpha class are highly related and encode enzymes with glutathione peroxidase activity. However, during evolution, this alpha class gene diverged accumulating mutations in the active site that resulted in differences in substrate specificity and catalytic activity. The enzyme encoded by this gene catalyzes the double bond isomerization of precursors for progesterone and testosterone during the biosynthesis of steroid hormones. An additional transcript variant has been identified, but its full length sequence has not been determined.
Form : Liquid
Molecular Mass : 50.530kDa inclusive of tags
AA Sequence : MAGKPKLHYFNGRGRMEPIRWLLAAAGVEFEEKFIGSAED LGKLRNDGSLMFQQVPMVEIDGIKLVQTRAILNYIASKYN LYGKDIKERALIDMYTEGMADLNEMILLLPLCRPEEKDAK IALIKEKTKSRYFPAFEKVLQSHGQDYLVGNKLSRADISL VELLYYVEELDSSLISNFPLLKALKTRISNLPTVKKFLQP GSPRKPPADAKALEEARKIFRF
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name GSTA3 glutathione S-transferase alpha 3 [ Homo sapiens ]
Official Symbol GSTA3
Synonyms GSTA3; glutathione S-transferase alpha 3; glutathione S transferase A3; glutathione S-transferase A3
Gene ID 2940
mRNA Refseq NM_000847
Protein Refseq NP_000838
MIM 605449
UniProt ID Q16772

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GSTA3 Products

Required fields are marked with *

My Review for All GSTA3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon