Recombinant Full Length Human GSDMC Protein, GST-tagged

• Cat.No.: GSDMC-6382HF
• Product Overview: Human MLZE full-length ORF ( AAH35321.1, 1 a.a. - 508 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: GSDMC (Gasdermin C) is a Protein Coding gene. An important paralog of this gene is GSDMA.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 84.1 kDa
• Protein length: 508 amino acids
• AA Sequence: MPSMLERISKNLVKEIGSKDLTSVKYLLSATKLRQFVILRKKKDSRSSFWEQSDYVPVEFSLNDILEPSSSVLETVVTGPFHFSDIMIQKHKADMGVNVGIEVSVSGEASVDHGCSLEFQIVTIPSPNLEDFQKRKLLDPEPSFLKECRRRGDNLYVVTEAVELINNTVLYDSSSVNILGKIALWITYGKGQGQGESLRVKKKALTLQKGMVMAYKRKQLVIKEKAILISDDDEQRTFQDEYEISEMVGYCAARSEGLLPSFHTISPTLFNASSNDMKLKPELFLTQQFLSGHLPKYEQVHILPVGRIEEPFWQNFKHLQEEVFQKIKTLAQLSKDVQDVMFYSILAMLRDRGALQDLMNMLELDSSGHLDGPGGAILKKLQQDSNHAWFNPKDPILYLLEAIMVLSDFQHDLLACSMEKRILLQQQELVRSILEPNFRYPWSIPFTLKPELLAPLQSEGLAITYGLLEECGLRTELDNPRSTWDVEAKMPLSALYGTLSLLQQLAEA
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GSDMC gasdermin C [ Homo sapiens ]
• Official Symbol: GSDMC
• Synonyms: GSDMC; gasdermin C; melanoma derived leucine zipper, extra nuclear factor , MLZE; gasdermin-C; melanoma-derived leucine zipper, extra-nuclear factor; melanoma-derived leucine zipper-containing extranuclear factor; MLZE
• Gene ID: 56169
• mRNA Refseq: NM_031415
• Protein Refseq: NP_113603
• MIM: 608384
• UniProt ID: Q9BYG8