Recombinant Full Length Human GSDMA Protein, C-Flag-tagged
Cat.No. : | GSDMA-813HFL |
Product Overview : | Recombinant Full Length Human GSDMA Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable phosphatidylinositol-4,5-bisphosphate binding activity; phosphatidylinositol-4-phosphate binding activity; and phosphatidylserine binding activity. Involved in apoptotic process. Located in perinuclear region of cytoplasm. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 49.2 kDa |
AA Sequence : | MTMFENVTRALARQLNPRGDLTPLDSLIDFKRFHPFCLVLRKRKSTLFWGARYVRTDYTLLDVLEPGSSP SDPTDTGNFGFKNMLDTRVEGDVDVPKTVKVKGTAGLSQNSTLEVQTLSVAPKALETLQERKLAADHPFL KEMQDQGENLYVVMEVVETVQEVTLERAGKAEACFSLPFFAPLGLQGSINHKEAVTIPKGCVLAFRVRQL MVKGKDEWDIPHICNDNMQTFPPGEKSGEEKVILIQASDVGDVHEGFRTLKEEVQRETQQVEKLSRVGQS SLLSSLSKLLGKKKELQDLELALEGALDKGHEVNLEALPKDVLLSKEAVGAILYFVGALTELSEAQQKLL VKSMEKKILPVQLKLVESTMEQNFLLDKEGVFPLQPELLSSLGDEELTLTEALVGLSGLEVQRSGPQYMW DPDTLPRLCALYAGLSLLQQLTKASTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | GSDMA gasdermin A [ Homo sapiens (human) ] |
Official Symbol | GSDMA |
Synonyms | GSDM; FKSG9; GSDM1 |
Gene ID | 284110 |
mRNA Refseq | NM_178171.5 |
Protein Refseq | NP_835465.2 |
MIM | 611218 |
UniProt ID | Q96QA5 |
◆ Recombinant Proteins | ||
Gsdma-1599R | Recombinant Rat Gsdma Protein, His-tagged | +Inquiry |
GSDMA-2217H | Recombinant Human GSDMA Protein, His-tagged | +Inquiry |
GSDMA-813HFL | Recombinant Full Length Human GSDMA Protein, C-Flag-tagged | +Inquiry |
GSDMA-1023H | Recombinant Human GSDMA Protein, His (Fc)-Avi-tagged | +Inquiry |
GSDMA-1045H | Recombinant Human GSDMA | +Inquiry |
◆ Cell & Tissue Lysates | ||
GSDMA-5727HCL | Recombinant Human GSDMA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GSDMA Products
Required fields are marked with *
My Review for All GSDMA Products
Required fields are marked with *
0
Inquiry Basket