Recombinant Full Length Human GRPEL2 Protein, GST-tagged

Cat.No. : GRPEL2-5605HF
Product Overview : Human GRPEL2 full-length ORF ( NP_689620.2, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
ProteinLength : 225 amino acids
Description : GRPEL2 (GrpE Like 2, Mitochondrial) is a Protein Coding gene. Among its related pathways are Metabolism of proteins and Mitochondrial protein import. GO annotations related to this gene include protein homodimerization activity and chaperone binding. An important paralog of this gene is GRPEL1.
Molecular Mass : 51.8 kDa
AA Sequence : MAVRSLWAGRLRVQRLLAWSAAWESKGWPLPFSTATQRTAGEDCRSEDPPDELGPPLAERALRVKAVKLEKEVQDLTVRYQRAIADCENIRRRTQRCVEDAKIFGIQSFCKDLVEVADILEKTTECISEESEPEDQKLTLEKVFRGLLLLEAKLKSVFAKHGLEKLTPIGDKYDPHEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVAVESQRRL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GRPEL2 GrpE-like 2, mitochondrial (E. coli) [ Homo sapiens ]
Official Symbol GRPEL2
Synonyms GRPEL2; GrpE-like 2, mitochondrial (E. coli); grpE protein homolog 2, mitochondrial; DKFZp451C205; FLJ23713; Mt GrpE#2; Mt-GrpE#2; FLJ33918;
Gene ID 134266
mRNA Refseq NM_152407
Protein Refseq NP_689620
MIM 618545
UniProt ID Q8TAA5

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GRPEL2 Products

Required fields are marked with *

My Review for All GRPEL2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon