Recombinant Full Length Human GRPEL2 Protein, GST-tagged

• Cat.No.: GRPEL2-5605HF
• Product Overview: Human GRPEL2 full-length ORF ( NP_689620.2, 1 a.a. - 225 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 225 amino acids
• Description: GRPEL2 (GrpE Like 2, Mitochondrial) is a Protein Coding gene. Among its related pathways are Metabolism of proteins and Mitochondrial protein import. GO annotations related to this gene include protein homodimerization activity and chaperone binding. An important paralog of this gene is GRPEL1.
• Molecular Mass: 51.8 kDa
• AA Sequence: MAVRSLWAGRLRVQRLLAWSAAWESKGWPLPFSTATQRTAGEDCRSEDPPDELGPPLAERALRVKAVKLEKEVQDLTVRYQRAIADCENIRRRTQRCVEDAKIFGIQSFCKDLVEVADILEKTTECISEESEPEDQKLTLEKVFRGLLLLEAKLKSVFAKHGLEKLTPIGDKYDPHEHELICHVPAGVGVQPGTVALVRQDGYKLHGRTIRLARVEVAVESQRRL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GRPEL2 GrpE-like 2, mitochondrial (E. coli) [ Homo sapiens ]
• Official Symbol: GRPEL2
• Synonyms: GRPEL2; GrpE-like 2, mitochondrial (E. coli); grpE protein homolog 2, mitochondrial; DKFZp451C205; FLJ23713; Mt GrpE#2; Mt-GrpE#2; FLJ33918
• Gene ID: 134266
• mRNA Refseq: NM_152407
• Protein Refseq: NP_689620
• MIM: 618545
• UniProt ID: Q8TAA5