Recombinant Full Length Human Gram Domain-Containing Protein 2(Gramd2) Protein, His-Tagged
Cat.No. : | RFL7948HF |
Product Overview : | Recombinant Full Length Human GRAM domain-containing protein 2(GRAMD2) Protein (Q8IUY3) (1-354aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-354) |
Form : | Lyophilized powder |
AA Sequence : | MTALSRSEATEEGGNQQMHRKTASLNSPVSCKEKPDRVEEPPDYSLHWPEGLKGEEIKKC GREGITLNKYNQQYHKLFKDVPLEEVVLKVCSCALQRDFLLQGRLYISPNWLCFHASLFG KDIKVVIPVVSVQMIKKHKMARLLPNGLAITTNTSQKYIFVSLLSRDSVYDLLRRVCTHL QPSSKKSLSVREFSGEPESLEVLIPEMKWRKVCPSSRSLSLPDNIPCIPPSSVDSTDSFF PSRKPPMSEKSRAQVASENGGRWAWPMPGWGPACPKKMPNCSPTAKNAVYEEDELEEEPR STGELRLWDYRLLKVFFVLICFLVMSSSYLAFRISRLEQQLCSLSWDDPVPGHR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GRAMD2A |
Synonyms | GRAMD2A; GRAMD2; GRAM domain-containing protein 2A |
UniProt ID | Q8IUY3 |
◆ Recombinant Proteins | ||
PLK4-203H | Recombinant Human polo-like kinase 4 Protein, His tagged | +Inquiry |
Tob2-6575M | Recombinant Mouse Tob2 Protein, Myc/DDK-tagged | +Inquiry |
FGF7-1523R | Recombinant Rhesus Macaque FGF7 Protein, His (Fc)-Avi-tagged | +Inquiry |
CPE-224H | Recombinant Human CPE, C13&N15-labeled | +Inquiry |
Spint1-8656M | Recombinant Mouse Spint1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1829P | Active Native Pisum Sativum Agglutinin Protein | +Inquiry |
IgE-18H | Native Human Immunoglobulin E, lambda | +Inquiry |
ACHE-8345H | Native Human ACHE | +Inquiry |
Fn1-5424M | Native Mouse Fibronectin | +Inquiry |
TSHB-704H | Native Human Thyroid Stimulating Hormone, Beta | +Inquiry |
◆ Cell & Tissue Lysates | ||
C14orf118-8291HCL | Recombinant Human C14orf118 293 Cell Lysate | +Inquiry |
SCARB1-2684MCL | Recombinant Mouse SCARB1 cell lysate | +Inquiry |
Tongue-532C | Cynomolgus monkey Tongue Lysate | +Inquiry |
CDC27-7662HCL | Recombinant Human CDC27 293 Cell Lysate | +Inquiry |
OSGIN2-3525HCL | Recombinant Human OSGIN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GRAMD2A Products
Required fields are marked with *
My Review for All GRAMD2A Products
Required fields are marked with *
0
Inquiry Basket