Recombinant Full Length Human GPX8 Protein, GST-tagged

• Cat.No.: GPX8-5589HF
• Product Overview: Human GPX8 full-length ORF ( NP_001008398.1, 1 a.a. - 209 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: GPX8 (Glutathione Peroxidase 8 (Putative)) is a Protein Coding gene. Among its related pathways are Glutathione metabolism and Cellular Senescence. GO annotations related to this gene include oxidoreductase activity and peroxidase activity. An important paralog of this gene is GPX7.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 50.3 kDa
• Protein length: 209 amino acids
• AA Sequence: MEPLAAYPLKCSGPRAKVFAVLLSIVLCTVTLFLLQLKFLKPKINSFYAFEVKDAKGRTVSLEKYKGKVSLVVNVASDCQLTDRNYLGLKELHKEFGPSHFSVLAFPCNQFGESEPRPSKEVESFARKNYGVTFPIFHKIKILGSEGEPAFRFLVDSSKKEPRWNFWKYLVNPEGQVVKFWRPEEPIEVIRPDIAALVRQVIIKKKEDL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GPX8 glutathione peroxidase 8 (putative) [ Homo sapiens ]
• Official Symbol: GPX8
• Synonyms: GPX8; glutathione peroxidase 8 (putative); probable glutathione peroxidase 8; EPLA847; UNQ847; GPx-8; GSHPx-8
• Gene ID: 493869
• mRNA Refseq: NM_001008397
• Protein Refseq: NP_001008398
• MIM: 617172
• UniProt ID: Q8TED1