Recombinant Full Length Human GPR162 Protein, GST-tagged

• Cat.No.: GPR162-5475HF
• Product Overview: Human GPR162 full-length ORF ( NP_055264.1, 1 a.a. - 304 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene was identified upon genomic analysis of a gene-dense region at human chromosome 12p13. It appears to be mainly expressed in the brain; however, its function is not known. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 59.5 kDa
• Protein length: 304 amino acids
• AA Sequence: MLSTGVVSFFSLKSDSAPPWMVLAVLWCSMAQTLLLPSFIWSCERYRADVRTVWEQCVAIMSEEDGDDDGGCDDYAEGRVCKVRFDANGATGPGSRDPAQVKLLPGRHMLFPPLERVHYLQVPLSRRLSHDETNIFSTPREPGSFLHKWSSSDDIRVLPAQSRALGGPPEYLGQRHRLEDEEDEEEAEGGGLASLRQFLESGVLGSGGGPPRGPGFFREEITTFIDETPLPSPTASPGHSPRRPRPLGLSPRRLSLGSPESRAVGLPLGLSAGRRCSLTGGEESARAWGGSWGPGNPIFPQLTL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GPR162 G protein-coupled receptor 162 [ Homo sapiens ]
• Official Symbol: GPR162
• Synonyms: A-2; GRCA; GPR162; G protein-coupled receptor 162
• Gene ID: 27239
• mRNA Refseq: NM_019858
• Protein Refseq: NP_062832
• UniProt ID: Q16538