Recombinant Full Length Human GPR141 Protein

• Cat.No.: GPR141-5633HF
• Product Overview: Human GPR141 full-length ORF (NP_861456.1) recombinant protein without tag.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• ProteinLength: 617 amino acids
• Description: GPR141 is a member of the rhodopsin family of G protein-coupled receptors (GPRs) (Fredriksson et al., 2003 [PubMed 14623098]).[supplied by OMIM
• Form: Liquid
• Molecular Mass: 35.5 kDa
• AA Sequence: MPGHNTSRNSSCDPIVTPHLISLYFIVLIGGLVGVISILFLLVKMNTRSVTTMAVINLVVVHSVFLLTVPFRLTYLIKKTWMFGLPFCKFVSAMLHIHMYLTFLFYVVILVTRYLIFFKCKDKVEFYRKLHAVAASAGMWTLVIVIVVPLVVSRYGIHEEYNEEHCFKFHKELAYTYVKIINYMIVIFVIAVAVILLVFQVFIIMLMVQKLRHSLLSHQEFWAQLKNLFFIGVILVCFLPYQFFRIYYLNVVTHSNACNSKVAFYNEIFLSVTAISCYDLLLFVFGGSHWFKQKIIGLWNCVLCR
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: GPR141 G protein-coupled receptor 141 [ Homo sapiens (human) ]
• Official Symbol: GPR141
• Synonyms: GPR141; G protein-coupled receptor 141; PGR13; probable G-protein coupled receptor 141; G-protein coupled receptor PGR13
• Gene ID: 353345
• mRNA Refseq: NM_001329993
• Protein Refseq: NP_001316922
• MIM: 609045
• UniProt ID: Q7Z602