Recombinant Full Length Human GPATCH3 Protein, GST-tagged

Cat.No. : GPATCH3-5495HF
Product Overview : Human GPATCH3 full-length ORF ( AAH07767.1, 1 a.a. - 525 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : GPATCH3 (G-Patch Domain Containing 3) is a Protein Coding gene. GO annotations related to this gene include nucleic acid binding.
Source : In Vitro Cell Free System
Species : Human
Tag : GST
Molecular Mass : 85.7 kDa
Protein length : 525 amino acids
AA Sequence : MAVPGEAEEEATVYLVVSGIPSVLRSAHLRSYFSQFREERGGGFLCFHYRHRPERAPPQAAPNSALIPTDPAAEGQLLSQTSATDVRPLSTRDSTPIQTRTCCCVISVRGLAQAQRLIRMYSGRRWLDSHGTWLPGRCLIRRLRLPTEASGLGSFPFKTRKELQSWKAENEAFTLADLKQLPELNPPVLMPRGNVGTPLRVFLELIRACRLPPRIITQLQLQFPKTGSSRRYGNVPFEYEDSETVEQEELVYTAEGEEIPQGTYLADIPASPCGEPEEEVGKEEEEESHSDEDDDRGEEWERHEALHEDVTGQERTTEQLFEEEIELKWEKGGSGLVFYTDAQFWQEEEGDFDEQTADDWDVDMSVYYDRDGGDKDARDSVQMRLEQRLRDGQEDGSVIERQVGTFERHTKGIGRKVMERQGWAEGQGLGCRCSGVPEALDSDGQHPRCKRGLGYHGEKLQPFGQLKRPRRNGLGLISTIYDEPLPQDQTESLLRRQPPTSMKFRTDMAFVRGSSCASDSPSLPD
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name GPATCH3 G patch domain containing 3 [ Homo sapiens ]
Official Symbol GPATCH3
Synonyms GPATCH3; G patch domain containing 3; GPATC3; G patch domain-containing protein 3; FLJ12455; DKFZp686E0221;
Gene ID 63906
mRNA Refseq NM_022078
Protein Refseq NP_071361
MIM 617486
UniProt ID Q96I76

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All GPATCH3 Products

Required fields are marked with *

My Review for All GPATCH3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon