Recombinant Full Length Human GNLY Protein, C-Flag-tagged
Cat.No. : | GNLY-1702HFL |
Product Overview : | Recombinant Full Length Human GNLY Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The product of this gene is a member of the saposin-like protein (SAPLIP) family and is located in the cytotoxic granules of T cells, which are released upon antigen stimulation. This protein is present in cytotoxic granules of cytotoxic T lymphocytes and natural killer cells, and it has antimicrobial activity against M. tuberculosis and other organisms. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 16.2 kDa |
AA Sequence : | MATWALLLLAAMLLGNPGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCL TIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIP STGPLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Full Length : | Full L. |
Gene Name | GNLY granulysin [ Homo sapiens (human) ] |
Official Symbol | GNLY |
Synonyms | LAG2; NKG5; LAG-2; D2S69E; TLA519 |
Gene ID | 10578 |
mRNA Refseq | NM_006433.5 |
Protein Refseq | NP_006424.2 |
MIM | 188855 |
UniProt ID | P22749 |
◆ Recombinant Proteins | ||
GNLY-1702HFL | Recombinant Full Length Human GNLY Protein, C-Flag-tagged | +Inquiry |
GNLY-5399HF | Recombinant Full Length Human GNLY Protein, GST-tagged | +Inquiry |
GNLY-4835H | Recombinant Human GNLY Protein, His-tagged | +Inquiry |
GNLY-1002H | Recombinant Human GNLY Protein, His (Fc)-Avi-tagged | +Inquiry |
GNLY-1101H | Recombinant Human GNLY Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNLY-5845HCL | Recombinant Human GNLY 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GNLY Products
Required fields are marked with *
My Review for All GNLY Products
Required fields are marked with *
0
Inquiry Basket