Recombinant Full Length Human GNB2 Protein, GST-tagged
Cat.No. : | GNB2-5358HF |
Product Overview : | Human GNB2 full-length ORF ( AAH10073, 1 a.a. - 340 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 340 amino acids |
Description : | Heterotrimeric guanine nucleotide-binding proteins (G proteins), which integrate signals between receptors and effector proteins, are composed of an alpha, a beta, and a gamma subunit. These subunits are encoded by families of related genes. This gene encodes a beta subunit. Beta subunits are important regulators of alpha subunits, as well as of certain signal transduction receptors and effectors. This gene contains a trinucleotide (CCG) repeat length polymorphism in its 5 UTR. [provided by RefSeq |
Molecular Mass : | 63.14 kDa |
AA Sequence : | MSELEQLRQEAEQLRNQIRDARKACGDSTLTQITAGLDPVGRIQMRTRRTLRGHLAKIYAMHWGTDSRLLVSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNFVACGGLDNICSIYSLKTREGNVRVSRELPGHTGYLSCCRFLDDNQIITSSGDTTCALWDIETGQQTVGFAGHSGDVMSLSLAPDGRTFVSGACDASIKLWDVRDSMCRQTFIGHESDINAVAFFPNGYAFTTGSDDATCRLFDLRADQELLMYSHDNIICGITSVAFSRSGRLLLAGYDDFNCNIWDAMKGDRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | GNB2 guanine nucleotide binding protein (G protein), beta polypeptide 2 [ Homo sapiens ] |
Official Symbol | GNB2 |
Synonyms | GNB2; guanine nucleotide binding protein (G protein), beta polypeptide 2; guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2; G protein; beta 2 subunit; guanine nucleotide binding protein G(I)/G(S)/G(T) beta subunit 2; signal transducing guanine nucleotide binding regulatory protein beta subunit; transducin beta chain 2; g protein subunit beta-2; G protein, beta-2 subunit; guanine nucleotide-binding protein G(I)/G(S)/G(T) beta subunit 2; signal-transducing guanine nucleotide-binding regulatory protein beta subunit; |
Gene ID | 2783 |
mRNA Refseq | NM_005273 |
Protein Refseq | NP_005264 |
MIM | 139390 |
UniProt ID | P62879 |
◆ Recombinant Proteins | ||
GNB2-5054H | Recombinant Human GNB2 Protein, GST-tagged | +Inquiry |
GNB2-5358HF | Recombinant Full Length Human GNB2 Protein, GST-tagged | +Inquiry |
GNB2-5215H | Recombinant Human GNB2 protein, GST-tagged | +Inquiry |
GNB2-2601R | Recombinant Rat GNB2 Protein | +Inquiry |
GNB2-2167Z | Recombinant Zebrafish GNB2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNB2-5863HCL | Recombinant Human GNB2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GNB2 Products
Required fields are marked with *
My Review for All GNB2 Products
Required fields are marked with *
0
Inquiry Basket