Recombinant Full Length Human GNAI2 Protein, C-Flag-tagged
Cat.No. : | GNAI2-944HFL |
Product Overview : | Recombinant Full Length Human GNAI2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene is an alpha subunit of guanine nucleotide binding proteins (G proteins). The encoded protein contains the guanine nucleotide binding site and is involved in the hormonal regulation of adenylate cyclase. Several transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 40.3 kDa |
AA Sequence : | MGCTVSAEDKAAAERSKMIDKNLREDGEKAAREVKLLLLGAGESGKSTIVKQMKIIHEDGYSEEECRQYR AVVYSNTIQSIMAIVKAMGNLQIDFADPSRADDARQLFALSCTAEEQGVLPDDLSGVIRRLWADHGVQAC FGRSREYQLNDSAAYYLNDLERIAQSDYIPTQQDVLRTRVKTTGIVETHFTFKDLHFKMFDVGGQRSERK KWIHCFEGVTAIIFCVALSAYDLVLAEDEEMNRMHESMKLFDSICNNKWFTDTSIILFLNKKDLFEEKIT HSPLTICFPEYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDAVTDVIIKNNLK DCGLFTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Axon guidance, Chemokine signaling pathway, Gap junction, Leukocyte transendothelial migration, Long-term depression, Melanogenesis, Progesterone-mediated oocyte maturation, Tight junction |
Full Length : | Full L. |
Gene Name | GNAI2 G protein subunit alpha i2 [ Homo sapiens (human) ] |
Official Symbol | GNAI2 |
Synonyms | GIP; HG1C; GNAI2B; H_LUCA15.1; H_LUCA16.1 |
Gene ID | 2771 |
mRNA Refseq | NM_002070.4 |
Protein Refseq | NP_002061.1 |
MIM | 139360 |
UniProt ID | P04899 |
◆ Recombinant Proteins | ||
GNAI2-31364TH | Recombinant Human FPR1 Protein | +Inquiry |
GNAI2-190H | Active Recombinant Human GNAI2 protein, GST-tagged | +Inquiry |
GNAI2-6953C | Recombinant Chicken GNAI2 | +Inquiry |
GNAI2-3757M | Recombinant Mouse GNAI2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Gnai2-1229M | Recombinant Mouse Gnai2 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GNAI2-5870HCL | Recombinant Human GNAI2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GNAI2 Products
Required fields are marked with *
My Review for All GNAI2 Products
Required fields are marked with *
0
Inquiry Basket