Recombinant Full Length Human Glycine Receptor Subunit Alpha-4(Glra4) Protein, His-Tagged
Cat.No. : | RFL35510HF |
Product Overview : | Recombinant Full Length Human Glycine receptor subunit alpha-4(GLRA4) Protein (Q5JXX5) (29-417aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (29-417) |
Form : | Lyophilized powder |
AA Sequence : | KEEVKSGTKGSQPMSPSDFLDKLMGRTSGYDARIRPNFKGPPVNVTCNIFINSFSSITKT TMDYRVNVFLRQQWNDPRLSYREYPDDSLDLDPSMLDSIWKPDLFFANEKGANFHEVTTD NKLLRIFKNGNVLYSIRLTLILSCLMDLKNFPMDIQTCTMQLESFGYTMKDLVFEWLEDA PAVQVAEGLTLPQFILRDEKDLGCCTKHYNTGKFTCIEVKFHLERQMGYYLIQMYIPSLL IVILSWVSFWINMDAAPARVGLGITTVLTMTTQSSGSRASLPKVSYVKAIDIWMAVCLLF VFAALLEYAAINFVSRQHKEFIRLRRRQRRQRLEEDIIQESRFYFRGYGLGHCLQARDGG PMEGSGIYSPQPPAPLLREGETTRKLYVD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GLRA4 |
UniProt ID | Q5JXX5 |
◆ Recombinant Proteins | ||
JAG1-1115HFL | Recombinant Full Length Human JAG1 Protein, C-Flag-tagged | +Inquiry |
BLE-1875S | Recombinant Staphylococcus aureus BLE protein, His-tagged | +Inquiry |
KHK-29896TH | Recombinant Human KHK, T7 -tagged | +Inquiry |
BIN-1662S | Recombinant Staphylococcus aureus (strain: SK1027, other: CdPc) BIN protein, His-tagged | +Inquiry |
TUBE1-11219Z | Recombinant Zebrafish TUBE1 | +Inquiry |
◆ Native Proteins | ||
Acetate Kinase-22B | Active Native Bacillus stearothermophilus Acetate Kinase | +Inquiry |
LH-12P | Native Porcine Luteinizing Hormone Protein | +Inquiry |
IgG-350R | Native RAT Gamma Globulin Fraction | +Inquiry |
PROS1-31218TH | Native Human PROS1 Protein | +Inquiry |
Collagen-316B | Native Bovine Collagen Type II | +Inquiry |
◆ Cell & Tissue Lysates | ||
PKIB-3157HCL | Recombinant Human PKIB 293 Cell Lysate | +Inquiry |
GNG2-5853HCL | Recombinant Human GNG2 293 Cell Lysate | +Inquiry |
LPCAT2-4671HCL | Recombinant Human LPCAT2 293 Cell Lysate | +Inquiry |
Brain-48R | Rat Brain Membrane Lysate | +Inquiry |
CD8A-2493HCL | Recombinant Human CD8A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GLRA4 Products
Required fields are marked with *
My Review for All GLRA4 Products
Required fields are marked with *
0
Inquiry Basket