Recombinant Full Length Human GLYATL2 Protein, GST-tagged

• Cat.No.: GLYATL2-5364HF
• Product Overview: Human GLYATL2 full-length ORF ( AAH16789.1, 1 a.a. - 294 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: GLYATL2 (Glycine-N-Acyltransferase Like 2) is a Protein Coding gene. Among its related pathways are Conjugation of carboxylic acids and Cytochrome P450 - arranged by substrate type. GO annotations related to this gene include transferase activity, transferring acyl groups other than amino-acyl groups and glycine N-acyltransferase activity. An important paralog of this gene is GLYATL1P3.
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 60.7 kDa
• Protein length: 294 amino acids
• AA Sequence: MLVLHNSQKLQILYKSLEKSIPESIKVYGAIFNIKDKNPFNMEVLVDAWPDYQIVITRPQKQEMKDDQDHYTNTYHIFTKASDKLEEVLSYSNVISWEQTLQIQGCQEGLDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNKKGNFSNMFIDASHAGLVNEHWAFGKNERSLKYIERCLQDFLGFGVLGPEGQLVSWIVMEQSCELRMGYTVPKYRHQGNMLQIGYHLEKYLSQKEIPFYFHVADNNEKSLQALNNLGFKICPCGWHQWKCTPKKYC
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GLYATL2 glycine-N-acyltransferase-like 2 [ Homo sapiens ]
• Official Symbol: GLYATL2
• Synonyms: GLYATL2; glycine-N-acyltransferase-like 2; glycine N-acyltransferase-like protein 2; BXMAS2 10; MGC24009; glycine acyltransferase family-B; acyl-CoA:glycine N-acyltransferase-like protein 2; GATF-B; BXMAS2-10
• Gene ID: 219970
• mRNA Refseq: NM_145016
• Protein Refseq: NP_659453
• MIM: 614762
• UniProt ID: Q8WU03