Recombinant Full Length Human GLYAT Protein, GST-tagged

• Cat.No.: GLYAT-5362HF
• Product Overview: Human GLYAT full-length ORF ( AAH09785.1, 1 a.a. - 163 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 163 amino acids
• Description: The glycine-N-acyltransferase protein conjugates glycine with acyl-CoA substrates in the mitochondria. The protein is thought to be important in the detoxification of endogenous and xenobiotic acyl-CoAs. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
• Molecular Mass: 44.9 kDa
• AA Sequence: MMLPLQGAQMLQMLEKTLRKSLPASLKVYGTVFHINHGNPFNLKAVVDKWPDFNTVVVCPQEQDMTDDLDHYTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAAIKSFKVKQTQRILYMAAETAKELTPFLLKSKILSPSGGKPKAM
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GLYAT glycine-N-acyltransferase [ Homo sapiens ]
• Official Symbol: GLYAT
• Synonyms: GLYAT; glycine-N-acyltransferase; glycine N-acyltransferase; ACGNAT; GAT; AAc; HRP-1(CLP); aralkyl-CoA N-acyltransferase; acyl-CoA:glycine N-acyltransferase; aralkyl acyl-CoA N-acyltransferase; aralkyl acyl-CoA:amino acid N-acyltransferase; CAT
• Gene ID: 10249
• mRNA Refseq: NM_005838
• Protein Refseq: NP_005829
• MIM: 607424
• UniProt ID: Q6IB77