Recombinant Full Length Human GLUL Protein, C-Flag-tagged
Cat.No. : | GLUL-2147HFL |
Product Overview : | Recombinant Full Length Human GLUL Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | The protein encoded by this gene belongs to the glutamine synthetase family. It catalyzes the synthesis of glutamine from glutamate and ammonia in an ATP-dependent reaction. This protein plays a role in ammonia and glutamate detoxification, acid-base homeostasis, cell signaling, and cell proliferation. Glutamine is an abundant amino acid, and is important to the biosynthesis of several amino acids, pyrimidines, and purines. Mutations in this gene are associated with congenital glutamine deficiency, and overexpression of this gene was observed in some primary liver cancer samples. There are six pseudogenes of this gene found on chromosomes 2, 5, 9, 11, and 12. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 41.9 kDa |
AA Sequence : | MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQS EGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLM GTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCE GISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKR HQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFS VTEALIRTCLLNETGDEPFQYKN myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Pathways : | Alanine, aspartate and glutamate metabolism, Arginine and proline metabolism, Metabolic pathways, Nitrogen metabolism |
Full Length : | Full L. |
Gene Name | GLUL glutamate-ammonia ligase [ Homo sapiens (human) ] |
Official Symbol | GLUL |
Synonyms | GS; GLNS; PIG43; PIG59 |
Gene ID | 2752 |
mRNA Refseq | NM_002065.7 |
Protein Refseq | NP_002056.2 |
MIM | 138290 |
UniProt ID | P15104 |
◆ Recombinant Proteins | ||
GLUL-553C | Recombinant Cynomolgus GLUL Protein, His-tagged | +Inquiry |
GLUL-153H | Recombinant Human GLUL Protein, His-tagged | +Inquiry |
Glul-8219R | Recombinant Rat Glul protein, His-tagged | +Inquiry |
Glul-1028M | Recombinant Mouse Glul Protein, MYC/DDK-tagged | +Inquiry |
GLUL-18H | Active Recombinant Human GLUL protein, His-tagged (Bioactivity Validated) | +Inquiry |
◆ Cell & Tissue Lysates | ||
GLUL-5890HCL | Recombinant Human GLUL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GLUL Products
Required fields are marked with *
My Review for All GLUL Products
Required fields are marked with *
0
Inquiry Basket