Recombinant Full Length Human GLRX5 Protein, GST-tagged

• Cat.No.: GLRX5-5349HF
• Product Overview: Human GLRX5 full-length ORF ( NP_057501.2, 1 a.a. - 157 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 157 amino acids
• Description: This gene encodes a mitochondrial protein, which is evolutionarily conserved. It is involved in the biogenesis of iron-sulfur clusters, which are required for normal iron homeostasis. Mutations in this gene are associated with autosomal recessive pyridoxine-refractory sideroblastic anemia. [provided by RefSeq, May 2010]
• Molecular Mass: 43 kDa
• AA Sequence: MSGSLGRAAAALLRWGRGAGGGGLWGPGVRAAGSGAGGGGSAEQLDALVKKDKVVVFLKGTPEQPQCGFSNAVVQILRLHGVRDYAAYNVLDDPELRQGIKDYSNWPTIPQVYLNGEFVGGCDILLQMHQNGDLVEELKKLGIHSALLDEKKDQDSK
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GLRX5 glutaredoxin 5 [ Homo sapiens ]
• Official Symbol: GLRX5
• Synonyms: GLRX5; glutaredoxin 5; C14orf87, chromosome 14 open reading frame 87, glutaredoxin 5 homolog (S. cerevisiae); glutaredoxin-related protein 5, mitochondrial; GRX5; PR01238; glutaredoxin 5 homolog; monothiol glutaredoxin-5; FLB4739; PRO1238; C14orf87; MGC14129
• Gene ID: 51218
• mRNA Refseq: NM_016417
• Protein Refseq: NP_057501
• MIM: 609588
• UniProt ID: Q86SX6