Recombinant Full Length Human GIP Protein, C-Flag-tagged
Cat.No. : | GIP-1568HFL |
Product Overview : | Recombinant Full Length Human GIP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes an incretin hormone and belongs to the glucagon superfamily. The encoded protein is important in maintaining glucose homeostasis as it is a potent stimulator of insulin secretion from pancreatic beta-cells following food ingestion and nutrient absorption. This gene stimulates insulin secretion via its G protein-coupled receptor activation of adenylyl cyclase and other signal transduction pathways. It is a relatively poor inhibitor of gastric acid secretion. |
Source : | Mammalian cells |
Species : | Human |
Tag : | Flag |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 4.9 kDa |
AA Sequence : | MVATKTFALLLLSLFLAVGLGEKKEGHFSALPSLPVGSHAKVSSPQPRGPRYAEGTFISDYSIAMDKIHQ QDFVNWLLAQKGKKNDWKHNITQREARALELAGQANRKEEEAVEPQSSPAKNPSDEDLLRDLLIQELLAC LLDQTNLCRLRSRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Full Length : | Full L. |
Gene Name | GIP gastric inhibitory polypeptide [ Homo sapiens (human) ] |
Official Symbol | GIP |
Synonyms | gastric inhibitory polypeptide; glucose-dependent insulinotropic polypeptide |
Gene ID | 2695 |
mRNA Refseq | NM_004123.3 |
Protein Refseq | NP_004114.1 |
MIM | 137240 |
UniProt ID | P09681 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All GIP Products
Required fields are marked with *
My Review for All GIP Products
Required fields are marked with *
0
Inquiry Basket