Recombinant Full Length Human GINS1 Protein, GST-tagged

• Cat.No.: GINS1-5263HF
• Product Overview: Human GINS1 full-length ORF ( AAH12542.1, 1 a.a. - 196 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 196 amino acids
• Description: The yeast heterotetrameric GINS complex is made up of Sld5 (GINS4; MIM 610611), Psf1, Psf2 (GINS2; MIM 610609), and Psf3 (GINS3; MIM 610610). The formation of the GINS complex is essential for the initiation of DNA replication in yeast and Xenopus egg extracts (Ueno et al., 2005 [PubMed 16287864]).[supplied by OMIM
• Molecular Mass: 47.3 kDa
• AA Sequence: MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEAKSGGRSDLIPTIKFRHCSLLRNRRCTVAYLYDRLLRIRALRWEYGSILPNALRFHMAAEEMEWFNNYKRSLATYMRSLGGDEGLDITQDMKPPKSLYIEVRCLKDYGEFEVDDGTSVLLKKNSQHFLPRWKCEQLIRQGVLEHILS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GINS1 GINS complex subunit 1 (Psf1 homolog) [ Homo sapiens ]
• Official Symbol: GINS1
• Synonyms: GINS1; GINS complex subunit 1 (Psf1 homolog); DNA replication complex GINS protein PSF1; KIAA0186; PSF1; partner of sld five-1; RP4-691N24.2
• Gene ID: 9837
• mRNA Refseq: NM_021067
• Protein Refseq: NP_066545
• MIM: 610608
• UniProt ID: Q14691