Recombinant Full Length Human Ghrelin O-Acyltransferase(Mboat4) Protein, His-Tagged
Cat.No. : | RFL13379HF |
Product Overview : | Recombinant Full Length Human Ghrelin O-acyltransferase(MBOAT4) Protein (Q96T53) (1-435aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-435) |
Form : | Lyophilized powder |
AA Sequence : | MEWLWLFFLHPISFYQGAAFPFALLFNYLCIMDSFSTRARYLFLLTGGGALAVAAMGSYA VLVFTPAVCAVALLCSLAPQQVHRWTFCFQMSWQTLCHLGLHYTEYYLHEPPSVRFCITL SSLMLLTQRVTSLSLDICEGKVKAASGGFRSRSSLSEHVCKALPYFSYLLFFPALLGGSL CSFQRFQARVQGSSALHPRHSFWALSWRGLQILGLECLNVAVSRVVDAGAGLTDCQQFEC IYVVWTTAGLFKLTYYSHWILDDSLLHAAGFGPELGQSPGEEGYVPDADIWTLERTHRIS VFSRKWNQSTARWLRRLVFQHSRAWPLLQTFAFSAWWHGLHPGQVFGFVCWAVMVEADYL IHSFANEFIRSWPMRLFYRTLTWAHTQLIIAYIMLAVEVRSLSSLWLLCNSYNSVFPMVY CILLLLLAKRKHKCN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MBOAT4 |
Synonyms | MBOAT4; GOAT; OACT4; FKSG89; Ghrelin O-acyltransferase; Membrane-bound O-acyltransferase domain-containing protein 4; O-acyltransferase domain-containing protein 4 |
UniProt ID | Q96T53 |
◆ Recombinant Proteins | ||
SDAD1-7957M | Recombinant Mouse SDAD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SULT1A3-6378H | Recombinant Human SULT1A3 Protein (Met1-Leu295), N-His tagged | +Inquiry |
DDIT4L-7855H | Recombinant Human DDIT4L protein, GST-tagged | +Inquiry |
SPXA-0031B | Recombinant Bacillus subtilis SPXA protein, His-tagged | +Inquiry |
RAG2-29371TH | Recombinant Human RAG2 | +Inquiry |
◆ Native Proteins | ||
NFL-01P | Native Pig NFL Protein (549 AA) | +Inquiry |
RWX-308S | Native Snake RVV-X ACTIVATOR | +Inquiry |
Artery-015H | Human Artery Lysate, Total Protein | +Inquiry |
Lectin-1802L | Active Native Lycopersicon Esculentum Lectin Protein, DyLight 488 Labeled | +Inquiry |
MB-238E | Native Horse Myoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
PHB2-3240HCL | Recombinant Human PHB2 293 Cell Lysate | +Inquiry |
DDX19B-7017HCL | Recombinant Human DDX19B 293 Cell Lysate | +Inquiry |
HIGD1A-5562HCL | Recombinant Human HIGD1A 293 Cell Lysate | +Inquiry |
HA-748HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
FAM96A-6338HCL | Recombinant Human FAM96A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MBOAT4 Products
Required fields are marked with *
My Review for All MBOAT4 Products
Required fields are marked with *
0
Inquiry Basket