Recombinant Full Length Human GFER Protein, GST-tagged

• Cat.No.: GFER-5317HF
• Product Overview: Human GFER full-length ORF ( AAH28348, 1 a.a. - 125 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 125 amino acids
• Description: The hepatotrophic factor designated augmenter of liver regeneration (ALR) is thought to be one of the factors responsible for the extraordinary regenerative capacity of mammalian liver. It has also been called hepatic regenerative stimulation substance (HSS). The gene resides on chromosome 16 in the interval containing the locus for polycystic kidney disease (PKD1). The putative gene product is 42% similar to the scERV1 protein of yeast. The yeast scERV1 gene had been found to be essential for oxidative phosphorylation, the maintenance of mitochondrial genomes, and the cell division cycle. The human gene is both the structural and functional homolog of the yeast scERV1 gene. [provided by RefSeq
• Molecular Mass: 39.49 kDa
• AA Sequence: MRTQQKRDTKFREDCPPDREELGRHSWAVLHTLAAYYPDLPTPEQQQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GFER growth factor, augmenter of liver regeneration [ Homo sapiens ]
• Official Symbol: GFER
• Synonyms: GFER; growth factor, augmenter of liver regeneration; growth factor, erv1 (S. cerevisiae) like (augmenter of liver regeneration); FAD-linked sulfhydryl oxidase ALR; ALR; ERV1; ERV1 homolog (S. cerevisiae); HERV1; HPO1; HPO2; HSS; ERV1 homolog; hepatopoietin protein; erv1-like growth factor; hepatic regenerative stimulation substance; HPO
• Gene ID: 2671
• mRNA Refseq: NM_005262
• Protein Refseq: NP_005253
• MIM: 600924
• UniProt ID: P55789