Recombinant Full Length Human GCET2 Protein, GST-tagged

• Cat.No.: GCET2-5168HF
• Product Overview: Human GCET2 full-length ORF ( AAH30506, 1 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a protein which may function in signal transduction pathways and whose expression is elevated in germinal cell lymphomas. It contains a putative PDZ-interacting domain, an immunoreceptor tyrosine-based activation motif (ITAM), and two putative SH2 binding sites. In B cells, its expression is specifically induced by interleukin-4. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 45.32 kDa
• Protein length: 178 amino acids
• AA Sequence: MGNSLLRENRRQQNTQEMPWNVRMQSPKQRTSRCWDHHIAEGCFCLPWKKILIFEKRQDSQNENERMSSTPIQDNVDQTYSEELCYTLINHRVLCTRPSGNSAEEYYENVPCKAERPRESLGGTETEYSLLHMPSTDPRHARSPEDEYELLMPHRISSHFLQQPRPLMAPSETQFSHL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GCET2 germinal center expressed transcript 2 [ Homo sapiens ]
• Official Symbol: GCET2
• Synonyms: GCET2; germinal center expressed transcript 2; germinal center B-cell-expressed transcript 2 protein; HGAL; human germinal center associated lymphoma; MGC40441; human germinal center-associated lymphoma; germinal center-associated lymphoma protein; GCAT2
• Gene ID: 257144
• mRNA Refseq: NM_001190259
• Protein Refseq: NP_001177188
• MIM: 607792
• UniProt ID: Q8N6F7