Recombinant Full Length Human GBP1 Protein, C-Flag-tagged
Cat.No. : | GBP1-2023HFL |
Product Overview : | Recombinant Full Length Human GBP1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Guanylate binding protein expression is induced by interferon. Guanylate binding proteins are characterized by their ability to specifically bind guanine nucleotides (GMP, GDP, and GTP) and are distinguished from the GTP-binding proteins by the presence of 2 binding motifs rather than 3. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 67.8 kDa |
AA Sequence : | MASEIHMTGPMCLIENTNGRLMANPEALKILSAITQPMVVVAIVGLYRTGKSYLMNKLAGKKKGFSLGST VQSHTKGIWMWCVPHPKKPGHILVLLDTEGLGDVEKGDNQNDSWIFALAVLLSSTFVYNSIGTINQQAMD QLYYVTELTHRIRSKSSPDENENEVEDSADFVSFFPDFVWTLRDFSLDLEADGQPLTPDEYLTYSLKLKK GTSQKDETFNLPRLCIRKFFPKKKCFVFDRPVHRRKLAQLEKLQDEELDPEFVQQVADFCSYIFSNSKTK TLSGGIQVNGPRLESLVLTYVNAISSGDLPCMENAVLALAQIENSAAVQKAIAHYEQQMGQKVQLPTESL QELLDLHRDSEREAIEVFIRSSFKDVDHLFQKELAAQLEKKRDDFCKQNQEASSDRCSGLLQVIFSPLEE EVKAGIYSKPGGYRLFVQKLQDLKKKYYEEPRKGIQAEEILQTYLKSKESMTDAILQTDQTLTEKEKEIE VERVKAESAQASAKMLQEMQRKNEQMMEQKERSYQEHLKQLTEKMENDRVQLLKEQERTLALKLQEQEQL LKEGFQKESRIMKNEIQDLQTKMRRRKACTIS myc-FLAG tag |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | GBP1 guanylate binding protein 1 [ Homo sapiens (human) ] |
Official Symbol | GBP1 |
Synonyms | guanylate binding protein 1, interferon-inducible, 67kDa; OTTHUMP00000012352 |
Gene ID | 2633 |
mRNA Refseq | NM_002053.3 |
Protein Refseq | NP_002044.2 |
MIM | 600411 |
UniProt ID | P32455 |
◆ Recombinant Proteins | ||
GBP1-13181H | Recombinant Human GBP1 protein, His-tagged | +Inquiry |
GBP1-28991TH | Recombinant Human GBP1 | +Inquiry |
GBP1-13180H | Recombinant Human GBP1, GST-tagged | +Inquiry |
GBP1-5526H | Recombinant Human GBP1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
GBP1-4776H | Recombinant Human GBP1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GBP1-1686HCL | Recombinant Human GBP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GBP1 Products
Required fields are marked with *
My Review for All GBP1 Products
Required fields are marked with *
0
Inquiry Basket