Recombinant Full Length Human GATA1 Protein, GST-tagged

• Cat.No.: GATA1-6938HF
• Product Overview: Recombinant Human full-length GATA1(1 a.a. - 413 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 413 amino acids
• Description: This gene encodes a protein which belongs to the GATA family of transcription factors. The protein plays an important role in erythroid development by regulating the switch of fetal hemoglobin to adult hemoglobin. Mutations in this gene have been associated with X-linked dyserythropoietic anemia and thrombocytopenia.
• Molecular Mass: 69.2 kDa
• AA Sequence: MEFPGLGSLGTSEPLPQFVDPALVSSTPESGVFFPSGPEGLDAAASSTAPSTATAAAAALAYYRDAEAYRHSPVF QVYPLLNCMEGIPGGSPYAGWAYGKTGLYPASTVCPTREDSPPQAVEDLDGKGSTSFLETLKTERLSPDLLTLGP ALPSSLPVPNSAYGGPDFSSTFFSPTGSPLNSAAYSSPKLRGTLPLPPCEARECVNCGATATPLWRRDRTGHYLC NACGLYHKMNGQNRPLIRPKKRLIVSKRAGTQCTNCQTTTTTLWRRNASGDPVCNACGLYYKLHQVNRPLTMRKD GIQTRNRKASGKGKKKRGSSLGGTGAAEGPAGGFMVVAGGSGSGNCGEVASGLTLGPPGTAHLYQGLGPVVLSGP VSHLMPFPGPLLGSPTGSFPTGPMPPTTSTTVVAPLSS
• Applications: ELISA; WB-Re; AP; Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GATA1 GATA binding protein 1 (globin transcription factor 1) [ Homo sapiens (human) ]
• Official Symbol: GATA1
• Synonyms: GATA1; GATA binding protein 1 (globin transcription factor 1); GATA binding protein 1 (globin transcription factor 1) , GF1; erythroid transcription factor; ERYF1; GATA 1; NFE1
• Gene ID: 2623
• mRNA Refseq: NM_002049
• Protein Refseq: NP_002040
• MIM: 305371
• UniProt ID: P15976