Recombinant Full Length Human GALP Protein, GST-tagged

• Cat.No.: GALP-5373HF
• Product Overview: Human GALP full-length ORF ( AAI48723.1, 1 a.a. - 116 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 116 amino acids
• Description: This gene encodes a member of the galanin family of neuropeptides. The encoded protein binds galanin receptors 1, 2 and 3 with the highest affinity for galanin receptor 3 and has been implicated in biological processes involving the central nervous system including hypothalamic regulation of metabolism and reproduction. A peptide encoded by a splice variant of this gene, termed alarin, may have vasoactive properties and serve as a marker for neuroblastic tumors
• Molecular Mass: 39.71 kDa
• AA Sequence: MAPPSVPLVLLLVLLLSLAETPASAPAHRGRGGWTLNSAGYLLGPVLHLPQMGDQDGKRETALEILDLWKAIDGLPYSHPPQPSKRNVMETFAKPEIGDLGMLSMKIPKEEDVLKS
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: GALP galanin-like peptide [ Homo sapiens ]
• Official Symbol: GALP
• Synonyms: GALP; galanin-like peptide; alarin; gal-like peptide
• Gene ID: 85569
• mRNA Refseq: NM_001145546
• Protein Refseq: NP_001139018
• MIM: 611178
• UniProt ID: Q9UBC7