Recombinant Human GPR84 protein, GST-tagged

• Cat.No.: GPR84-52H
• Product Overview: Recombinant Human GPR84(208 a.a. - 316 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• ProteinLength: 208-316 a.a.
• Description: GPR84 played an important role in many functions.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 37.73 kDa
• AA Sequence: AAQALDQYKLRQASIHSNHVARTDEAMPGRFQELDSRLASGGPSEGISSEPVSAATTQTLEGDSSEVGDQINSKR AKQMAEKSPPEASAKAQPIKGARRAPDSSSEFGK
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

Gene Information

• Gene Name: GPR84 G protein-coupled receptor 84 [ Homo sapiens ]
• Official Symbol: GPR84
• Synonyms: GPR84; G protein-coupled receptor 84; G-protein coupled receptor 84; EX33; inflammation-related G protein-coupled receptor EX33; inflammation-related G-protein coupled receptor EX33; GPCR4
• Gene ID: 53831
• mRNA Refseq: NM_020370
• Protein Refseq: NP_065103
• MIM: 606383
• UniProt ID: Q9NQS5
• Chromosome Location: 12q13.13
• Pathway: GPCRs, Other, organism-specific biosystem
• Function: G-protein coupled receptor activity; receptor activity; signal transducer activity