Recombinant Full Length Human FXYD6 Protein, GST-tagged

• Cat.No.: FXYD6-5280HF
• Product Overview: Human FXYD6 full-length ORF ( AAH18652, 1 a.a. - 95 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 95 amino acids
• Description: This reference sequence was derived from multiple replicate ESTs and validated by human genomic sequence. This gene encodes a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing 7 invariant and 6 highly conserved amino acids. The approved human gene nomenclature for the family is FXYD-domain containing ion transport regulator. FXYD2, also known as the gamma subunit of the Na,K-ATPase, regulates the properties of that enzyme. FXYD1 (phospholemman), FXYD2 (gamma), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems. Transmembrane topology has been established for two family members (FXYD1 and FXYD2), with the N-terminus extracellular and the C-terminus on the cytoplasmic side of the membrane. This gene product, FXYD6, is novel and has not been characterized as a protein. Multiple alternatively spliced transcript variants that encode the same protein isoform have been described. RefSeq curation by Kathleen J. Sweadner, Ph.D., sweadner@helix.mgh.harvard.edu.
• Molecular Mass: 36.19 kDa
• AA Sequence: MELVLVFLCSLLAPMVLASAAEKEKEMDPFHYDYQTLRIGGLVFAVVLFSVGILLILSRRCKCSFNQKPRAPGDEEAQVENLITANATEPQKAEN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: FXYD6 FXYD domain containing ion transport regulator 6 [ Homo sapiens (human) ]
• Official Symbol: FXYD6
• Synonyms: FXYD6; FXYD domain containing ion transport regulator 6; FXYD domain-containing ion transport regulator 6; phosphohippolin; FXYD Domain Containing Ion Transport Regulator 6; Phosphohippolin; FXYD Domain-Containing Ion Transport Regulator 6
• Gene ID: 53826
• mRNA Refseq: NM_001164831
• Protein Refseq: NP_001158303
• MIM: 606683
• UniProt ID: Q9H0Q3